KEGG   Kazachstania africana: KAFR_0E01810Help
Entry
KAFR_0E01810      CDS       T02487                                 

Gene name
KAFR0E01810
Definition
hypothetical protein
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
kaf  Kazachstania africana
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    KAFR_0E01810 (KAFR0E01810)
Enzymes [BR:kaf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     KAFR_0E01810 (KAFR0E01810)
Protein kinases [BR:kaf01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   KAFR_0E01810 (KAFR0E01810)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(372094..373524)
Genome map
AA seq 476 aa AA seqDB search
MTEKIERHTFKVFNQDFTVDKRFQLIKEIGHGAYGIVCSAKFVEVPEETTVAIKKVTNVF
SKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFYPDGSLNGLYLYEELMECDMHQIIK
SSQPLTDAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSE
NPVENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSTGCILAEFLGGKPIFKGKDYVH
QLNQILQVLGTPPDETLKRIGSKNVQDYIHQLGYIPTIPFSNLYPDANPQALDLLERMLA
FDPQKRITVDEALQHPYLSIWHDPADEPICSEKFDFGFEVVTDMEDLKQMVIEEVNDFRK
FVRQPLIEEEKLQQQRQQEVTQHDQQNDNNLQGIQNADFSNQMGGPQTSISAQLQDFGIH
SENLRAHETDFPPRPQENLLASPIALDSGRDERLAGNDELLDLEKELEFGLDRKYL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgacagagaagattgaaaggcatacattcaaagtgtttaatcaggacttcaccgttgat
aaacgtttccaactgattaaagagataggtcatggtgcttacggtattgtctgctcggct
aaatttgtagaagtccctgaagagaccactgtggccatcaaaaaggtcaccaatgtcttt
tcaaagactttgctatgcaaaagatcactacgagagttgaagttactaaggcactttcga
ggtcataagaatatcacatgtctgtacgatatggatattgtcttttaccctgatggttca
ctaaatggattatatttatatgaagaattaatggaatgtgatatgcatcaaatcattaaa
tctagtcaaccgttgacagacgctcattatcaaagtttcatttatcaaattttgtgtggt
ttgaaatatattcattctgcggatgttctacatcgtgatttaaaaccaggaaatttacta
gtgaatgcagattgtcaattgaaaatttgtgattttggtctcgcaagaggctattcagaa
aatcctgtagaaaataaccaatttttaactgagtatgtggccacgagatggtatcgtgca
ccagaaatcatgttgagttaccaaggttacactaaagccatagatgtctggtcaacggga
tgtatccttgccgagtttttaggtgggaaacctatattcaaaggtaaagactacgttcat
caattaaatcaaattttacaagtcctgggtacacctcccgatgaaactttgaaaagaatt
ggatcaaaaaatgtacaagactatattcatcaactcgggtatatcccaacaatccccttt
agcaatctctatcctgacgcaaatccgcaagctttggatctattggaaaggatgttagca
ttcgatccgcagaagagaatcaccgtagatgaggccttacaacatccttacttgtcgata
tggcatgatcctgcagatgaaccaatctgtagcgaaaaattcgattttggttttgaagta
gtgaccgatatggaggacttgaagcaaatggtcattgaagaggtcaatgatttcaggaaa
tttgtaagacagccgcttatagaagaggaaaaactgcaacagcaacgacaacaggaggtg
acgcagcatgatcaacagaatgacaacaatttacaaggaatacaaaatgcagatttttca
aatcaaatgggtggtcctcaaacttcaatatctgcacaactacaagattttggaatacat
tcagaaaatttacgagcacatgaaactgattttcctccaaggccgcaagaaaacttactg
gcatcaccaattgcattagattcaggtcgtgatgaaaggcttgctggaaacgatgaattg
ctcgacttagaaaaggaactggaattcggattagatagaaaatatttatga

DBGET integrated database retrieval system