KEGG   Kazachstania africana: KAFR_0E02950Help
Entry
KAFR_0E02950      CDS       T02487                                 

Gene name
KAFR0E02950
Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
kaf  Kazachstania africana
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KAFR_0E02950 (KAFR0E02950)
Enzymes [BR:kaf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     KAFR_0E02950 (KAFR0E02950)
Exosome [BR:kaf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KAFR_0E02950 (KAFR0E02950)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(592163..593818)
Genome map
AA seq 551 aa AA seqDB search
MTEVNENTALLGTSPTKSRFRLKAKTRKIMIATFVLFALAALLFQISDSSTVPHTKPKSD
NKKNVIFFVTDGMGPASLSLARSFRQYKYDLPMNDTLFLDHYLIGSSRTRSSDSLVTDSA
AGATAFSCALKSYNGAIGVDPFNAPCGTILEGAKLNGYMTGLVVTTRITDATPASFSAHA
DFRIQEDLIALHQLGNYPLGRMVDLMIGGGRTHYYSGKSRYGPSGTRKDNRNLIDEAINN
GWQYVGSRSEFDSLKLGHNVSLPLLGLLADYDIPFDLDRSHSKYPSLEEQTITALNALSA
ATKNSDKGFFLLVEGSRIDHAGHQNDPAAQVREVLAFDRAFKAAVEFAENSDVETILIST
SDHETGGLVTARQVTDDYPEYLWYPQVLDNAQHSGEYLQMKILNYDGNNKKEFVAKEVLK
NDLNITDYTENDLHELVTLADGSKLQEKLNDMVSVRAQVGWTTHGHSAVDVNIYAFANKQ
ETWLDILKNLQGNHENTEIGSFMARYMGIDLVKVTGLINETDHSAGINVKEINRVDLYDK
YHHKLLNLRND
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagtcaatgaaaatacagcattactgggcacaagccctacaaaatcacgattt
agattgaaggcaaaaactcgtaaaatcatgatcgctacgtttgttcttttcgcattagca
gcattactatttcaaatatctgattctagcacagttcctcatacaaagccaaagagcgat
aacaagaaaaatgttatcttctttgttacagacggtatgggaccagcttctttgtcgcta
gcaagatcctttagacagtataagtacgatttgccgatgaatgatacgctgtttttagat
cattacctaattggctcatctcgtactagatcttctgattctttagtaactgactctgct
gcgggtgccaccgctttttcatgtgcactgaagtcatacaatggtgctattggtgtggat
ccctttaacgctccatgtggtactatcctagaaggggctaaattaaatggctacatgacg
ggtctggttgttaccacaagaattactgacgctactcctgcttcctttagtgcacatgca
gattttagaatacaagaagatttaatcgccttgcaccaattgggaaattatcctttgggt
aggatggtagatttgatgataggtggaggtagaacacattactattcaggtaaatcacga
tatggaccatctggtacacgtaaagataatagaaatctaattgatgaagcaattaataac
gggtggcagtacgtaggctcgcgtagtgaattcgattctttgaaactaggccacaatgtc
tcgttaccattattgggtctcttagcagattatgatatcccattcgatcttgatagaagt
cattccaagtatccttctttggaagaacaaactataactgcattaaacgcattgtcagct
gcaacaaagaattctgataaaggtttctttttattagtagaaggttcaagaattgaccac
gcgggtcatcaaaatgatccagctgctcaagtcagagaggttttggcttttgatagagca
ttcaaagctgctgttgaattcgcagaaaactctgacgtagaaacaattttaatttctaca
tctgatcatgaaactggaggactagttaccgccagacaagtgactgatgactatccagaa
tatctttggtatccacaagttctcgataatgcacaacattctggtgaatatctacaaatg
aagattttaaactatgacggaaacaataaaaaagaatttgttgcaaaagaggttttaaag
aatgatcttaacatcactgattatactgaaaatgatttacatgaactggttactctagca
gacggttctaaacttcaggaaaagctaaatgatatggtctcagttagagctcaggttggg
tggacaacacatggccatagcgcagtagacgttaatatttatgcttttgcaaataagcaa
gagacttggcttgatattttgaaaaatctacaaggtaatcatgaaaatactgaaataggt
tcattcatggccagatatatgggcattgatcttgtaaaagttacgggcttaattaatgaa
actgaccactctgctggaattaatgttaaagaaattaaccgggttgatttatatgataaa
tatcatcataaattattgaatttgcgcaacgactag

DBGET integrated database retrieval system