KEGG   Kazachstania africana: KAFR_0F03900Help
Entry
KAFR_0F03900      CDS       T02487                                 

Gene name
KAFR0F03900
Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
kaf  Kazachstania africana
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:763094..764203
Genome map
AA seq 369 aa AA seqDB search
MARTVTFDIPAEYQLIDLIGEGAYGTVCSAIHKPSNIKVAIKKIQPFSKNLFVTRTLREV
KLLRYFHNHENVISILDKVRPISIEKMNNVYLVQELMETDLQKIINNSATGLGSTLTDDH
IQYFTYQILRALKSIHSAKVIHRDLKPSNLLLNSNCDLKVCDFGLARCLASSSDSRETLV
GIMTEYVATRWYRAPEIMLSFQEYTTAMDIWSVGCILAEMVSGKPLFPGRDYHHQLWYIL
EVLGTPEYDDFRQIKSKRAKEYIANLPMKAPMSWGVVFANRKDLNPDMLDLLTKMLMFNP
DKRISAAEALKHPYLTTYHDPEDEPEYPPLDLDDEFWKIDNEVKKSDEDEMSMDVLRQML
YDELMKPLK
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggctagaaccgtaacatttgatattccggcggagtatcaactaatcgatctaattggt
gaaggcgcatatggtaccgtatgctctgcaattcataagccatcaaacataaaagttgcc
atcaaaaaaattcaaccattcagcaagaatttatttgtgacaagaactttgagagaagtc
aagttattaagatactttcataatcatgaaaacgtaattagcatactggataaagtcagg
ccgatttccatagaaaagatgaacaatgtttaccttgttcaagagttgatggaaacagat
ttacaaaagattattaataacagcgccactgggttaggctcgacattaactgatgaccat
atacagtatttcacttatcagatcttaagggcgttaaaatccattcatagtgctaaagtc
atacacagagacttgaaaccttctaatttgttactaaactcgaactgtgatttgaaagtt
tgcgattttggtctagcgagatgcttagcgagcagtagtgattctagagaaactttggtt
ggaatcatgacggagtacgtagcaaccagatggtatagagccccagagattatgttatcg
ttccaagaatacacaacagcaatggacatatggtctgtcggttgtatacttgctgagatg
gtctccggaaaaccattgtttcctggaagagactatcatcatcaactttggtatatcctg
gaagtactcggtacaccagaatatgatgatttccgacaaatcaaatcgaagagggcgaaa
gaatacatagctaatctacctatgaaagcgccgatgtcatggggcgtagtctttgctaat
aggaaggacctaaaccccgacatgctagatcttcttaccaagatgctgatgttcaatcct
gacaagaggatcagcgcagctgaagcgctcaaacatccatacctcaccacatatcacgac
ccagaagatgaaccagaatacccaccattggatctcgatgatgagttttggaaaatagac
aatgaagttaagaaatcggatgaggacgaaatgtccatggatgttctaaggcagatgctc
tatgatgaactcatgaagcctttaaaataa

DBGET integrated database retrieval system