KEGG   Kazachstania africana: KAFR_0G00220Help
Entry
KAFR_0G00220      CDS       T02487                                 

Gene name
KAFR0G00220
Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
kaf  Kazachstania africana
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KAFR_0G00220 (KAFR0G00220)
Enzymes [BR:kaf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     KAFR_0G00220 (KAFR0G00220)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(75805..76815)
Genome map
AA seq 336 aa AA seqDB search
MGITIVGSLNYDLVTFTSRIPDSGETFRASNFETHAGGKGLNQTVAISRLRKPNADYPVR
MIGNVGDDSFGRELLDVLSQNKVDTSHVGALAGVNTGVANIIVEQEKGGQNRILIVEGAN
GGTVYTSDELKSLFDSMYSQKEMVVLQHEIPDPVSIMKWVNENKPGYQIVYNPSPFQPLK
RDSWALVDILVVNEIEALQVAQCTYDGNHLRSIKDSVNKDFIEGYKQLCKLFQADLVNEN
KSATVIITLGVKRRLFSSKAQPDVGYLPAVTGIKVVDTTGAGDTFLGAVVTQLYEGEQLA
TGISFATTASSLAIQKSGAAESIPSHAEVNAATGDS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgggtattactatcgtaggttcactaaattacgacttggttactttcacaagtcgtatt
cctgactctggtgagacctttagggcaagtaatttcgagactcatgctggtggtaaaggt
ttgaaccagacagtcgcaatttctaggttgagaaagcctaatgctgattaccccgttcgt
atgatcggtaacgttggtgacgattcatttggtagggagttgctggatgttttaagccag
aacaaagttgatacctctcatgtaggagctttagcaggggtcaataccggtgtggccaat
attatagtagagcaagagaaaggtggtcaaaatagaattcttatagtggagggtgctaat
ggagggactgtttacacgtcggatgagcttaagagtctgttcgattccatgtattctcag
aaggaaatggtggttctacaacacgagattcctgatcctgtttcaatcatgaaatgggtg
aatgagaacaaaccaggttaccagatagtttataatccttcaccttttcaaccactgaag
agggatagctgggcccttgtagatatactggtggtaaatgaaattgaggcattacaagtc
gcccaatgcacatatgatgggaatcacctccgttctatcaaagattctgtaaataaagat
tttattgaaggctataaacagttatgtaagttattccaggctgatttagtaaacgagaat
aagtcagctacagttataattacgttgggggtaaagaggcgtttattttcgtcaaaggca
caacctgatgttgggtacctgcctgcagtaaccggcatcaaagtggttgatactacaggt
gctggcgataccttcttaggtgcagtggtcacgcaactttatgagggggagcaattagcc
accggtatatcgtttgcgacaacagcaagctcactagcaatccagaaaagtggtgccgct
gaaagtataccatctcatgcagaggtaaatgctgcaacaggagatagttag

DBGET integrated database retrieval system