KEGG   Kazachstania africana: KAFR_0G00890Help
Entry
KAFR_0G00890      CDS       T02487                                 

Gene name
KAFR0G00890
Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
kaf  Kazachstania africana
Brite
Enzymes [BR:kaf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     KAFR_0G00890 (KAFR0G00890)
Peptidases [BR:kaf01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   KAFR_0G00890 (KAFR0G00890)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(211229..211933)
Genome map
AA seq 234 aa AA seqDB search
MNKELDAVIPLESDPEVFNTFAHNLGLKREYSFVDIYSIDDPALLEFLVRPVMAIILLFP
PVETKEAVQTNNKDIDTSTDKPIWLRQNFKNACGLYALLHILANNKQLLADDSSLLKFIN
DIPNFTDTDLSKFIIEFINHFNADFVHNSGSSVNPNPDDIIDLHFITFISYGDENKLYEL
DGRSAEGKPIYIGQGHGKDLIEEELIVNRIRGYMNSVKDENDKLKFSLIGLSVS
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggaattagatgctgttatcccgctagaatcggacccagaagtgttcaatacc
ttcgcgcacaatctgggtcttaagagagagtacagttttgtagacatatactcaattgat
gatcctgcactgttggaatttctagtgagacccgttatggctatcatactcttgtttcca
cccgttgaaaccaaggaagcagtgcagacaaacaacaaagatatcgatacatccactgac
aaacctatttggttgaggcaaaatttcaagaatgcatgtggattgtatgcactgctacat
atcttggccaacaataaacagttattagcggatgattcaagcttactgaagtttataaac
gatatcccgaattttactgatacggatttgagtaaatttatcattgaatttatcaatcat
ttcaatgcagattttgttcataattctggttcctcagtaaatccaaatccagatgatata
attgatttacatttcattacttttatatcatatggcgatgaaaataaactgtatgaatta
gatggcagatctgctgaaggtaagccaatttacattggacaaggtcatggtaaagatctc
attgaagaggaactaatagtcaatagaatcaggggatacatgaatagcgtcaaagatgaa
aatgataaattaaaattctccctgataggtttaagtgtgtcttaa

DBGET integrated database retrieval system