KEGG   Kazachstania africana: KAFR_0G01240Help
Entry
KAFR_0G01240      CDS       T02487                                 

Gene name
KAFR0G01240
Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
kaf  Kazachstania africana
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    KAFR_0G01240 (KAFR0G01240)
Enzymes [BR:kaf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     KAFR_0G01240 (KAFR0G01240)
Exosome [BR:kaf04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   KAFR_0G01240 (KAFR0G01240)
  Exosomal proteins of colorectal cancer cells
   KAFR_0G01240 (KAFR0G01240)
  Exosomal proteins of bladder cancer cells
   KAFR_0G01240 (KAFR0G01240)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(280112..281788)
Genome map
AA seq 558 aa AA seqDB search
MMPLSFKSLALGCFLMFSQFFTAIRAQDIVLTDAIATDNTDIQKLSLSDFTKYIKSHDLV
LAEFTMPWCPHSKILLPTLMEAATRLKEHDINVIQINCENDTMLCSHLTIEKYPTLKVIK
KHRLGNTPEYTGTRTVDAIVQFMLDQTTSAVHKIESDEEMENYLQDVKLPVVVNNGLSEL
SKVFGETAENLINQFVFVSNPNNHSNEVTLYIPRYNITGNSTSLETAVYDGSVEDLVSNP
KKLSSWLSYSILPYFMDGTPETLALYMKSDLPLAYFFYSDRHDFENYRDMFNDLGKTYRG
KINFIALNSNIAQNHVKFLDLKQQYPIFVIHDSSTNFRYALPQLPDDEYLELIKRNEMVH
VEKDDILKLVEDFANGEATPIMKSEEVPTVQDGLVYKLVSQTHDEIVHNPERDVIVRYYA
PWCSHSKRLAKVFEEMAGLFASNEEFKDKIMFADIDSTKNDLINFPVTTYPLVALYPAGS
TEPVIFSGIRIAEKILDFIKENGTHHIDGIPLLAEIRDVVKFDENGNVIHPEDTVSGTSS
DTSTSTSADASTVAHDEL
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctttaagcttcaaatcactcgctttaggatgttttcttatgttcagccagttt
ttcacggcaataagagctcaagatattgtcttgacagatgccattgcaacagacaatact
gatattcaaaaattatcactatcagattttaccaagtatattaagagtcacgatttggtt
ctagcggaatttaccatgccatggtgtcctcattcgaaaattcttctaccaactttaatg
gaagctgccacacgtctaaaagagcatgatattaatgttattcaaataaattgtgaaaat
gatactatgctatgttctcatctgactatcgagaagtaccctactttgaaagttatcaag
aaacaccgtttgggtaatacccctgaatatactggtacaagaactgttgatgccatagtt
caatttatgctagatcagacaacttcggcagttcacaagatcgaatcagatgaagaaatg
gaaaattacttacaggatgtcaaattacccgttgttgttaataatgggttatcggaactt
tcgaaggtttttggtgaaactgctgaaaatctcatcaatcagttcgttttcgtatcaaat
cctaataatcattcaaatgaagttactttgtacatccctagatacaatatcactggtaac
tcaacttctttggaaacagcagtatacgatgggtctgttgaggacttagtttctaatcca
aagaaactctcaagctggttgtcatactccatcttaccttatttcatggatggtactcct
gaaactttagctttatacatgaaaagtgacttacctttggcctatttcttttacagtgat
agacatgactttgagaattatagagacatgtttaatgacttaggtaaaacttatcgtggg
aaaataaactttattgccctaaactcgaacatcgcacaaaatcatgttaagttcttggat
ttgaaacaacaatacccaatatttgtaattcacgattcaagtaccaacttcagatatgct
ttgccacaattgccagacgacgaatacctggagctcataaagagaaatgaaatggtacat
gtagagaaagatgatatattgaaattggttgaagacttcgctaatggagaggctacgcca
ataatgaaatctgaagaagtccctacagtacaagatggcttagtgtataaactggtcagt
caaacgcacgatgaaattgttcacaatcctgaaagggatgtcatagttagatattatgca
ccatggtgttcacatagcaaaaggcttgcaaaggttttcgaagagatggcaggtcttttt
gcatcaaatgaagagtttaaagataagataatgtttgccgatatagattccaccaagaac
gatttaattaacttcccagttacgacttatccacttgtagcattataccccgcaggcagt
acggaacctgtcatattcagtggcataagaattgcggagaagattctagattttatcaaa
gaaaatggtacccatcatattgatggcattccactccttgctgaaataagagatgtcgtt
aaatttgatgaaaacggtaatgttatccatcctgaagataccgtttcaggtacttcttca
gatacttccacaagcacctctgcagacgcttctacagtggcacatgatgaattatag

DBGET integrated database retrieval system