KEGG   Kazachstania africana: KAFR_0G02770Help
Entry
KAFR_0G02770      CDS       T02487                                 

Gene name
KAFR0G02770
Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
kaf  Kazachstania africana
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KAFR_0G02770 (KAFR0G02770)
Enzymes [BR:kaf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     KAFR_0G02770 (KAFR0G02770)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:574974..576566
Genome map
AA seq 530 aa AA seqDB search
MLSELKKLPVNSKVGVVGSGVAGLTFTYFLHKLRPDVNVKLFDAQQRTGGWIHSCNVDTL
SGGSKVMLEKGPRTLRGVSDGTVLIIDSLMNLGGSDKIKCITKDSSANKKFILSPDDKLV
QVPDSIGSFGKFCMSPLSKGFLTGIGFEWARKSKRDDVDESVESFVKRRYGSQAISDNLM
SALYHGIYADDVSTLSAKRIMRKSYDDELKFGSFFKAYLRRSKMKKGLSECLKEYCHVFN
KDTKELMELSNTLKKYPMIGLSKGLETFPNMIREEISKSSNVEIITDKRINRINRLKNNK
IELKDKNGVIDTFDHVRVTLTPPKILELLPTSYKEIRNKLIEIESNTVILINFYLEDKNI
IPKEYSSFGYLIPKSNKNDEKVLGVIFDSVIEQNFQPLFADNGDKLLSKRDYTKMTVMLG
GHLLNDVDGKAQIPEDPQKVIERVKDALQRHIKNITREDLNRGLWQYTVAEDCLPRFNVG
YDALAQEIEREVLTRFHGNVSLGGMGFSTGPGIPDVIVDGFKDSVELSQK
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgctatcagaactcaagaaactacctgtaaactctaaagtaggcgtcgtaggaagtgga
gtagcgggcttaacattcacgtatttcttacataagttaagacctgatgtgaatgtcaag
ttatttgatgctcaacaacgcacgggtggatggattcactcttgcaacgtggatacattg
agtggtggaagtaaagtgatgctggaaaaaggtcccaggacattgcgaggagtttctgac
gggacagtgctaataattgacagtttaatgaatcttggtggatccgataagattaaatgc
attaccaaagattccagtgcaaataaaaagtttatactgtcacctgatgataaattggtt
caagtacccgattctattggtagttttggtaaattttgtatgagtcctttgagtaaagga
tttcttacgggtattggatttgaatgggcaagaaaatccaaacgagatgatgtcgatgaa
agtgtagaatcgtttgttaagagacggtacggtagtcaagctataagtgataatttgatg
agtgcactatatcatggtatatatgctgatgatgtttctacattaagtgcgaagagaatt
atgcgtaaatcatacgatgatgaattgaaatttggatcatttttcaaagcttacttacga
agaagtaaaatgaagaaaggattaagtgaatgtttgaaagaatattgtcacgtatttaat
aaagatactaaagaattgatggaattatccaacactttgaaaaaataccccatgattgga
ctaagtaaagggctagagacctttccaaacatgattagagaagaaatttcaaaatcttca
aatgttgaaattataactgataagcgtattaatagaataaatagactaaaaaataataag
attgagcttaaagataagaatggggtaattgatacttttgatcacgttagagtgacatta
acaccgccaaagattctcgaattattaccaacttcatacaaggagatacgaaacaaatta
attgaaattgaaagtaatacggtgatattgattaacttctatctcgaagataaaaatatt
atacctaaggagtattccagctttggatatttaataccgaagagtaataagaatgatgaa
aaagtattaggcgtcatatttgattctgtcatcgaacaaaacttccaaccactttttgcg
gataatggagataaattactatctaaaagagattatacaaaaatgaccgtaatgcttgga
ggccatttattaaatgatgtagatgggaaggctcaaataccagaggatccccaaaaagta
attgaacgagtgaaagatgctttacaaagacacatcaagaacatcacccgagaggatttg
aaccgtggattatggcaatatacagtagccgaagactgtttaccacgtttcaatgttgga
tacgatgcattagctcaagagattgaaagagaagttttaacaagattccatgggaacgtt
tctcttggtgggatgggattttccacgggacccggtattcccgacgtcattgtcgatggt
ttcaaagattccgttgaattgtcacaaaaatag

DBGET integrated database retrieval system