KEGG   Kazachstania africana: KAFR_0H00890Help
Entry
KAFR_0H00890      CDS       T02487                                 

Gene name
KAFR0H00890
Definition
hypothetical protein
Orthology
K11482  
histone deacetylase HOS1 [EC:3.5.1.98]
Organism
kaf  Kazachstania africana
Brite
Enzymes [BR:kaf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     KAFR_0H00890 (KAFR0H00890)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:167453..168877
Genome map
AA seq 474 aa AA seqDB search
MTKLIIAASSWQSQVADLLPCNNYKKSQLTYSLLRAYGLFEYFDYIIELPKCSKPELLDF
HPREYVDVLMHPDFNFVLPYDNDEATWNHLNHVAFDWKNTHTDEQLVEKFEINVCQSRDK
LFELFEELSDSTLEPKSNPKKRLASDLLLEEQNVASDRITDLVSAETRQLFNLEGDCPIF
SYLPMYLQVTTGATLSLSKFLVPNSKDRTICINWDGGRHHASKKKASGFCYINDIVLLIQ
RMRKNGFKKITYLDFDLHHGDGVEKAFQFSKSIQTISLHLFETGFFPGTGGLSNKGSRDL
IDIPLSHGLTDDYLFELVKQIIIPAIDLHAAEAIVLQCGGDGLSGDKFNEWQLTIKGLTQ
CIIDVIGKFSDCQIVLLGGGGYNELLVSRFYTYLTWKVVQKYSTLLEENKSIISDDDTEL
VVEHEYIEMYANEHYKFWIYEIEGSSKHRILKDYNEPGSIERFKRHYGLCNEDG
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaactgataattgcggcttcatcatggcaatcacaggtagcagatttgttaccg
tgcaataactacaagaaatcccaattaacgtattctttgttaagggcttacggattattt
gaatattttgactatatcatcgaacttcccaaatgttccaagcctgagctgctagacttt
catcctagggagtatgtggatgtccttatgcacccagatttcaatttcgtattgccgtat
gataatgacgaagcaacatggaatcatctcaaccatgtggcttttgattggaaaaatacc
catacagacgagcaattggttgaaaaatttgaaattaacgtgtgtcaatcgagagataaa
ctttttgaattgtttgaagaactctctgattcgacattggagcccaaaagcaatcccaag
aagagattagcatctgatcttcttctagaggaacagaatgtggctagtgacagaattact
gacttggtgtcagccgaaacaagacaacttttcaacttagaaggagattgtccaatattt
tcttacttaccaatgtatctacaagtcactactggtgctactttatcactgtcaaagttt
ttggtaccaaactcaaaggacagaactatatgtataaattgggatggtggaagacatcac
gcctcaaaaaagaaagcaagtgggttttgctatattaacgatatagtactacttatccaa
cgtatgaggaaaaatgggttcaaaaaaattacctatttggattttgatctccatcatggt
gatggtgtggagaaagcctttcaattctcaaaatcaatacagacaatttcattacatcta
ttcgaaacaggcttctttccaggaacaggtggattaagtaataaaggatcccgtgacctt
atagatataccattatctcatggattaactgacgattacctttttgaattagtgaagcaa
ataatcattccagcaatagatttacacgcagctgaagctattgtattacaatgtggtggt
gacggcctatctggtgacaaatttaacgaatggcagttgactattaaaggtcttacacag
tgtataatcgatgtgattgggaaattttccgattgtcagattgttcttcttggtggcgga
gggtacaacgagttattagtcagtaggttctatacttacttaacctggaaagtcgtccag
aaatattccactttattggaagagaacaaatccattatttcagacgatgatacagaactt
gtagtggaacatgaatatatcgagatgtatgcaaacgaacactataaattctggatatat
gagatagaaggcagctccaaacaccgtattctcaaggactacaacgaaccaggatctata
gagcggtttaagagacattacggattatgtaatgaggacggttga

  All links  
No link information was found.   
DBGET integrated database retrieval system