KEGG   Kazachstania africana: KAFR_0H01040Help
Entry
KAFR_0H01040      CDS       T02487                                 

Gene name
KAFR0H01040
Definition
hypothetical protein
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
kaf  Kazachstania africana
Brite
Enzymes [BR:kaf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     KAFR_0H01040 (KAFR0H01040)
Protein kinases [BR:kaf01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   KAFR_0H01040 (KAFR0H01040)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(189604..190860)
Genome map
AA seq 418 aa AA seqDB search
MSFTNALNNNTQLLNQQQDPNESSIKNKSSSKIKNLLYSQLESFSTYLQTNRTIYESTKF
SIPNRYEVVEVLGKGSYGIVCSVRDKSNSNPETLLAIKKITNIFQREILLKRAIRELKFL
KFFRGHKNIINLIDLEILYSENNPQYNGLYCYQELIDYDLAKIIHSNVSLTEFHIKYFFY
QILCGLKYIHSAEVIHRDLKPGNILVTLNGCLKICDFGLARGISNQFQLKQENKKTKPIT
NYVATRWYRAPELILSQNTYTKAIDLWAIGCILAEFYTRKPIFMGNDSIHQTFEIIKVLG
FPPTHLLVKFNSLKSLNLLKNKTMTPGKKIPWSTYLPFASNDAWDLLDHLLTWEPELRYT
AAEAIEHRFVQSVRTLQDEPECYNGPFNFSYEGNLDSMAKLREYLIGEVTEFKKSETI
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttacaaatgctttgaataataatacgcaacttttaaatcagcagcaagatcca
aatgaatcgtctataaaaaataaaagttcaagtaagattaaaaatttattgtactcacaa
ttagaaagcttttctacatatttacaaacaaatcgaaccatatacgaaagtaccaaattt
tcaattccaaatcgctacgaagtcgttgaggtattaggaaaaggttcatatggtatagta
tgttctgttcgagataaatcaaattcaaatccagaaacacttctagcaataaaaaagata
actaatatctttcagagggaaattttactcaaacgtgcaataagagaattgaaattcttg
aaattcttcagaggtcataaaaatatcatcaatcttattgacttagagatattgtattcg
gaaaataaccctcaatacaatggtttatattgttatcaagaattaattgattatgatttg
gccaaaatcattcattcaaacgtttcattgactgagtttcacataaaatatttcttctat
caaatattatgtggcttaaaatatattcatagtgcagaagtgattcacagagacttgaaa
cctggtaatatacttgtgacgttgaatggctgtctcaagatatgcgattttggtctggcc
agaggtatctccaatcaatttcaattgaagcaagagaataaaaagacgaaaccaattaca
aactatgttgcaacaaggtggtatcgagctcccgaactgattttatcccaaaatacatac
acgaaggcaattgacctctgggcgattggttgtatcttagcagaattctacacaagaaag
ccaatttttatgggaaacgattcaatacatcaaacattcgaaataatcaaagttctagga
ttccctcctacccacttgttggtgaaatttaattcattaaaatcgttaaatcttctgaaa
aataaaacaatgacaccaggaaagaaaataccctggtcaacttatcttccctttgcttca
aacgatgcttgggacttattagaccatctattgacctgggaaccagaactgagatatacc
gctgcggaagccattgagcacaggttcgtgcagtcggtaagaaccttacaagatgaacct
gaatgctataatggaccattcaatttttcatatgagggaaatcttgattctatggctaaa
ctcagagagtacttgatcggggaagtaaccgagtttaaaaagtctgaaacgatataa

DBGET integrated database retrieval system