KEGG   Kazachstania africana: KAFR_0H02220Help
Entry
KAFR_0H02220      CDS       T02487                                 

Gene name
KAFR0H02220
Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
kaf  Kazachstania africana
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:kaf00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(422907..424631)
Genome map
AA seq 574 aa AA seqDB search
MVSSSSSVEQTKISKQYKSGSPKRPSLTRKRSSQRLIRTISIETDDEEYLSPGLVVSDAL
TEVHSGSVVNTLPTGELDQIDNKADELPNLTSLKIANENTHKSNDYIEVPFVKASLDATL
PEDYLRNDIWNVIQALKIPRWHNRQNLILDRLKLIKISGAMTNAIFKIEYPKLPSLLLRI
YGSNNDLIIDRDYELEILARLSVRNIGPSLFGCFTNGRFEQFLENSTTLTFQDLRDWKTS
QRIARRMKELHNGVPLLKAEIEDGPVCWKKINNWVNILDSKQWVHNDENIKKVFHCQDWE
FFKKVVKRYYDWLLKSNFYDSKMVFCHNDAQYGNLLFSAPVVEIEDDKSSVSSTKTTASS
LFPSNSNVHLDRIINPPKQERSQDSKLVVIDFEYAGANPAAYDLANHLSEWMYNYTGKEP
HRTLTSEYPTKEQILNFLYSYVSHLRGGSSSSSSSSNIDHEVKYYYNLIIKWRATVQIFW
SLWGVLQSGVLEEKDTEIIFEGTNGEKYIIKEDPDASFNDDVEDHIIEGVSIDTFDYLKY
CSDKIAVFWGDLIKLQIIDESDCMKSKMLDTQLI
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgtcctcttcttctgttgagcagacgaagatatcgaaacagtacaaatctggt
agtcccaagagaccttcattgacgaggaaaaggtcgtctcagagacttattaggacaatc
agtatagagacagatgacgaggagtatctttccccaggtttagtggtatcagatgcactg
acagaagtgcactctggctcagtggtgaatacgttacccactggtgaattggaccaaatt
gataataaggctgatgaattaccgaatctgacaagtttgaaaatcgccaatgagaatact
cataagtctaatgattacatcgaggttccctttgttaaggcatcgttggatgccacatta
ccggaagattatttgagaaatgatatatggaacgttattcaagctttaaagatacctaga
tggcataatagacaaaatttaatcttagataggttgaaattgattaagatatcgggtgca
atgacaaatgcgatctttaaaatcgagtatccaaaacttccatcgttgttattaagaatt
tatggttccaataatgatcttatcattgatagggactatgaattagaaattttggctaga
ttatcggttcgtaacattggaccttcattgtttggatgcttcacaaatggcagattcgaa
caatttcttgagaactctacgacattgactttccaggatctaagagattggaaaacatct
caacgtatcgcaagaagaatgaaagaattacacaacggtgttccattactgaaagcagaa
attgaagatggaccagtgtgttggaaaaagattaataattgggtgaatatccttgatagc
aagcagtgggtccataatgatgaaaatattaagaaagtatttcattgtcaagattgggaa
ttctttaaaaaagtggtaaagagatattatgattggttattaaaatctaatttttacgat
tctaaaatggtgttttgtcataacgatgcacaatacggtaatttactgttcagtgccccc
gtcgtagaaatcgaagatgataaaagttctgtatcttccacgaaaacgacagcatcctca
ctttttccatcaaattctaacgttcatctcgatagaattatcaatcccccaaaacaagaa
agaagtcaggactctaaattagtagtcattgatttcgaatacgcaggtgccaatcctgct
gcatacgatctagccaaccatttgagtgagtggatgtacaattacacggggaaagaacct
catagaacgctcacaagtgaatatccaacgaaggaacaaattctcaattttctgtactcc
tacgtttctcaccttcgtggtggcagcagcagtagtagttccagtagcaacatcgatcac
gaggtcaaatactactataatttgataatcaagtggagggccacagtccaaatattctgg
agtctttggggtgttctacaaagtggtgtgctggaagaaaaagatacagaaattatattt
gagggcaccaacggtgaaaaatacattatcaaagaggatccagatgcaagtttcaacgat
gatgttgaagaccacatcatcgaaggcgtcagtatagatacttttgattatttaaagtat
tgtagcgataaaattgcggttttctggggagatttgatcaaattacagataatcgacgag
tctgattgcatgaaaagcaagatgctggatacacagctcatataa

DBGET integrated database retrieval system