KEGG   Kazachstania africana: KAFR_0H02220Help
Entry
KAFR_0H02220      CDS       T02487                                 

Gene name
KAFR0H02220
Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
kaf  Kazachstania africana
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    KAFR_0H02220 (KAFR0H02220)
Enzymes [BR:kaf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     KAFR_0H02220 (KAFR0H02220)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(422907..424631)
Genome map
AA seq 574 aa AA seqDB search
MVSSSSSVEQTKISKQYKSGSPKRPSLTRKRSSQRLIRTISIETDDEEYLSPGLVVSDAL
TEVHSGSVVNTLPTGELDQIDNKADELPNLTSLKIANENTHKSNDYIEVPFVKASLDATL
PEDYLRNDIWNVIQALKIPRWHNRQNLILDRLKLIKISGAMTNAIFKIEYPKLPSLLLRI
YGSNNDLIIDRDYELEILARLSVRNIGPSLFGCFTNGRFEQFLENSTTLTFQDLRDWKTS
QRIARRMKELHNGVPLLKAEIEDGPVCWKKINNWVNILDSKQWVHNDENIKKVFHCQDWE
FFKKVVKRYYDWLLKSNFYDSKMVFCHNDAQYGNLLFSAPVVEIEDDKSSVSSTKTTASS
LFPSNSNVHLDRIINPPKQERSQDSKLVVIDFEYAGANPAAYDLANHLSEWMYNYTGKEP
HRTLTSEYPTKEQILNFLYSYVSHLRGGSSSSSSSSNIDHEVKYYYNLIIKWRATVQIFW
SLWGVLQSGVLEEKDTEIIFEGTNGEKYIIKEDPDASFNDDVEDHIIEGVSIDTFDYLKY
CSDKIAVFWGDLIKLQIIDESDCMKSKMLDTQLI
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgtcctcttcttctgttgagcagacgaagatatcgaaacagtacaaatctggt
agtcccaagagaccttcattgacgaggaaaaggtcgtctcagagacttattaggacaatc
agtatagagacagatgacgaggagtatctttccccaggtttagtggtatcagatgcactg
acagaagtgcactctggctcagtggtgaatacgttacccactggtgaattggaccaaatt
gataataaggctgatgaattaccgaatctgacaagtttgaaaatcgccaatgagaatact
cataagtctaatgattacatcgaggttccctttgttaaggcatcgttggatgccacatta
ccggaagattatttgagaaatgatatatggaacgttattcaagctttaaagatacctaga
tggcataatagacaaaatttaatcttagataggttgaaattgattaagatatcgggtgca
atgacaaatgcgatctttaaaatcgagtatccaaaacttccatcgttgttattaagaatt
tatggttccaataatgatcttatcattgatagggactatgaattagaaattttggctaga
ttatcggttcgtaacattggaccttcattgtttggatgcttcacaaatggcagattcgaa
caatttcttgagaactctacgacattgactttccaggatctaagagattggaaaacatct
caacgtatcgcaagaagaatgaaagaattacacaacggtgttccattactgaaagcagaa
attgaagatggaccagtgtgttggaaaaagattaataattgggtgaatatccttgatagc
aagcagtgggtccataatgatgaaaatattaagaaagtatttcattgtcaagattgggaa
ttctttaaaaaagtggtaaagagatattatgattggttattaaaatctaatttttacgat
tctaaaatggtgttttgtcataacgatgcacaatacggtaatttactgttcagtgccccc
gtcgtagaaatcgaagatgataaaagttctgtatcttccacgaaaacgacagcatcctca
ctttttccatcaaattctaacgttcatctcgatagaattatcaatcccccaaaacaagaa
agaagtcaggactctaaattagtagtcattgatttcgaatacgcaggtgccaatcctgct
gcatacgatctagccaaccatttgagtgagtggatgtacaattacacggggaaagaacct
catagaacgctcacaagtgaatatccaacgaaggaacaaattctcaattttctgtactcc
tacgtttctcaccttcgtggtggcagcagcagtagtagttccagtagcaacatcgatcac
gaggtcaaatactactataatttgataatcaagtggagggccacagtccaaatattctgg
agtctttggggtgttctacaaagtggtgtgctggaagaaaaagatacagaaattatattt
gagggcaccaacggtgaaaaatacattatcaaagaggatccagatgcaagtttcaacgat
gatgttgaagaccacatcatcgaaggcgtcagtatagatacttttgattatttaaagtat
tgtagcgataaaattgcggttttctggggagatttgatcaaattacagataatcgacgag
tctgattgcatgaaaagcaagatgctggatacacagctcatataa

DBGET integrated database retrieval system