KEGG   Kazachstania africana: KAFR_0H02790Help
Entry
KAFR_0H02790      CDS       T02487                                 

Gene name
KAFR0H02790
Definition
hypothetical protein
Orthology
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
kaf  Kazachstania africana
Brite
Enzymes [BR:kaf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     KAFR_0H02790 (KAFR0H02790)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(531813..533966)
Genome map
AA seq 717 aa AA seqDB search
MSQDKDPLEKFYLQFQKFVQNNPNVISAARAASQIPESAKAIVILSPYSLQHIFPREWVS
KSYKKTIVERPERLLAASMGIAAAITMYPALFTLKSSHNRLGSLHAPHVIKVHGSKWPNE
VIRLCHEADSKLREGKLEVPESWNAGDIYLNSDTIMALKGSIGAIETGVDSIFNGPSPEH
ICNRAFVAIRPPGHHCHVGMPSGFCLLNNANITIEYAANTYGVTHVVVLDFDLHHGDGTQ
DICWKRAGFKPDGNYIDEADSTGYDDFEKKMADFPKVGYFSMHDINSFPTESGYATRENI
KNASTCIMNSHDLNIWNVHLSKWSTEEDFLKLYRSKYRTLFAKADEFFKAAKLEMASMGK
PYKGLVLISSGFDASEFEQVSMQRHSVNVPTTFYTMFTKDALKLAQMHCHGKVISIMEGG
YSDKAITSGVFAHLIGLQNQDWIKEWGSEQVVKEIVRGCKPTWKPYKTKRNDDVIRVWAE
EVIRLGRSMIPEFDDVIFKEKLKLEKAKHSTFDGQTISQRVTRSIAAARETGVSMNDRII
KNELNVERVPVKQLINHKAQQHKVPFVEQDLSSEDEEDNDYVYDEELNKTFNRTVEDITI
DDISRHLETLEIIQDEEENENENERMVSQNPSSSSSSRSRTTGNGQRHLQSNGMYKIPSS
TTTQHLRHSRNSRTIPTANTYQHANNNTSIATYDDSDVSMISHISTKKHTTRSGGRW
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagataaagaccccttggagaaattttatttgcaatttcaaaaattcgttcaa
aataaccccaatgtcatatctgctgcgagagctgcttctcaaataccagagtctgctaaa
gctatagttattttgtctccttactctttacagcatattttccccagagaatgggtctct
aaatcgtataagaagactatagtagagagaccagaacgtctgctagctgcttcaatgggt
atagctgcagctattacaatgtacccggctttatttactttaaaatcatcccataacaga
ctaggttccttgcatgcacctcacgtgataaaagttcacggttccaaatggcccaatgag
gttataagactatgtcacgaggcagattcaaaattaagagagggaaagctggaagttccc
gagtcttggaatgctggtgacatatatttaaattctgacacaataatggctctgaaaggg
tctattggtgccatagaaacaggtgtagactctattttcaatggtccctccccggaacat
atatgtaatagagcgtttgtcgcaattcgtcccccagggcatcattgtcacgtaggtatg
ccatctggcttttgccttttaaataatgcaaatattacgattgagtatgctgccaatact
tatggtgtcacacatgttgttgtcttagattttgatttgcatcatggtgatggaacccaa
gatatttgttggaaacgtgcaggcttcaaaccagatggtaattacattgatgaagcagat
tccacaggttatgatgattttgagaaaaaaatggctgattttcctaaagttggttatttc
tcaatgcatgatattaattctttccctacagagtctggttacgctacaagagaaaacatt
aaaaatgcttcaacctgtataatgaattctcatgatttgaatatttggaacgtgcatcta
tctaaatggtccacagaagaagattttcttaaattataccgttccaaatatagaacttta
tttgccaaagctgatgaatttttcaaggctgcaaaactagagatggcatcgatgggtaaa
ccatataaaggtttagtcctaattagttccggttttgatgcctcagaattcgaacaggtg
tcgatgcaaagacatagcgttaacgttccaacaactttctatacaatgttcactaaagat
gctttgaagttagcacagatgcattgtcatgggaaagttatctccattatggaaggtggt
tattctgacaaagcaataacatccggtgtctttgcacatcttattggtttacaaaatcag
gattggataaaagaatgggggtctgaacaagtcgttaaagaaattgttcgtggttgtaaa
cctacttggaaaccttataagaccaagagaaatgatgatgttattagagtttgggcagaa
gaagttatcagactaggtagatcaatgattccagagtttgatgatgtcattttcaaagaa
aaactcaaacttgaaaaagcaaaacactcaactttcgatggtcaaactatttctcaaaga
gtaacaaggtcaattgctgcagcaagggaaactggtgtgtcgatgaacgacagaattata
aagaatgaactcaatgtggaaagggttcctgttaaacaattgatcaatcataaggcgcag
caacataaggtaccatttgtagagcaagacctttcaagcgaggatgaagaggataacgat
tacgtatatgatgaggagttgaataaaacattcaaccgtactgtggaggatattaccatc
gatgatatttcaagacatttagaaactttagaaatcattcaagatgaggaagaaaatgaa
aacgaaaatgaaagaatggtgtcacaaaatccatcttcttcctcttcttctagatcaaga
actacaggtaacggtcaacgtcacttacaaagtaatggaatgtataaaattccttcaagt
actacgacacagcatttaagacatagtcgtaactctcgtactataccgacagctaatacg
tatcaacacgccaataataacactagtattgcgacctatgatgatagtgatgtctctatg
atatctcatatctcgacaaaaaagcacaccactagaagcggtggtagatggtag

DBGET integrated database retrieval system