KEGG   Kazachstania africana: KAFR_0H02980Help
Entry
KAFR_0H02980      CDS       T02487                                 

Gene name
KAFR0H02980
Definition
(RefSeq) hypothetical protein
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
kaf  Kazachstania africana
Pathway
kaf00500  Starch and sucrose metabolism
kaf01100  Metabolic pathways
kaf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KAFR_0H02980 (KAFR0H02980)
Enzymes [BR:kaf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     KAFR_0H02980 (KAFR0H02980)
Exosome [BR:kaf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KAFR_0H02980 (KAFR0H02980)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase Glyco_hydro_66 AMPK1_CBM
Motif
Other DBs
NCBI-GeneID: 13887703
NCBI-ProteinID: XP_003958842
UniProt: H2AZF1
Position
8:569164..571278
Genome map
AA seq 704 aa AA seqDB search
MYQVPENVKAAIEFDPWLKPYGQVLSERRYLADKWSYDIKHATPDGSEQSLSQFARDSYK
SYGLHVNPKTNEITYKEWAPNAKNAFLVGEFNNWEKYTHQLEGKDEFGNFSITIPPTKTG
EAAIPHDSKIKVMFQLEDGTEIYRLPAWITRATQPSKETSKQYGPAYEGRFWNPPQPYKF
KNSRPKFNEKLNSLRIYEAHVGISSPEPKVTSYKEFTQKILPRIKYLGYDAIQLMAIMEH
AYYASFGYQVTNFFAASSRYGTPEDLKELVDTAHGMGILVLLDVVHSHASKNVEDGLNRF
DGSDHQYFHSLSSGRGEHPLWDSRLFNYGSFEVQRFLLANLAYYIDVYKFDGFRFDGVTS
MLYLHHGVGEGGAFSGDYDEYLSKERSAVDHEALAYLMLANDLVHELLPQSAVTIAEDVS
GYPTLCLPRSMGGAGFDYRLAMALPDMWIKLLKEKKDDDWDIGNIVFTLTNRRHGEKVVS
YCESHDQALVGDKTLAFWLMDAAMYTDMTVLKELSLVIDRGIALHKMIRLLTHSLGGEAY
LNFEGNEFGHPEWLDFPNVNNNDSYHYARRQFNLVDDHLLRYRHLNDFDRAMQLCEKKHQ
WLNTPQAYVSLKHEVDKVIVFERNGLLFIFNFHPTNSFTDYRVGVDQAGCYRIVLNSDRD
EFGGHDRIDESSKFYTTDLEWNNRRNFLQVYIPSRTAIVLALEK
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaggttcctgaaaatgttaaggctgcaattgaattcgacccttggttaaaacct
tacggtcaagttctttctgaaagacgttacttggctgataagtggtcatacgatatcaaa
catgctacccctgatggatctgaacaatctctatcgcaattcgccagagactcttacaaa
tcttatggtttacatgtgaatccaaagactaatgagatcacttacaaagaatgggctcca
aacgctaagaacgcttttctagtcggtgagttcaacaattgggaaaaatatactcatcaa
ctggaaggaaaagatgaattcggtaactttagtatcaccataccaccaactaaaacaggt
gaagccgctatcccacatgattctaaaattaaagtcatgttccaattggaagacggtact
gagatttatcgtctacctgcctggattaccagagccactcaaccatcaaaggaaacttct
aaacaatacggtcctgcttacgaaggtagattctggaatccacctcaaccatacaaattt
aagaattcaagaccaaaattcaatgagaaattgaactccttaagaatctatgaagctcat
gtcggcatctcatctcctgaaccaaaagtcacctcttacaaagaattcactcaaaagatc
ttaccaagaattaaatacttaggttacgatgccattcaactgatggctatcatggaacac
gcctactacgcttcctttggttaccaagtcaccaatttctttgctgcaagttcccgttat
ggtaccccagaagacttgaaagaattggtagacaccgctcatggtatgggtatcctagtc
ttattggatgtcgtccatagtcacgcttctaagaatgtagaagatggtttaaatagattt
gatggatcagatcatcaatatttccactctttatcctctggaagaggtgaacatccacta
tgggattctagattattcaattacggctctttcgaagtccaaaggttcctattagccaac
ttggcctactacattgacgtgtataagttcgatggtttcagatttgatggtgtcacctca
atgttatatctacatcacggtgttggtgaaggtggtgcattcagcggtgactacgatgaa
tacttatcaaaggaaagatccgcagttgatcatgaagcattggcgtacctaatgttagct
aacgaccttgttcacgaattattgcctcaatctgcagttactatcgctgaagatgtttca
ggctatccaaccttatgtttacctcgctcgatgggtggtgctggtttcgactatagactt
gccatggctttacctgacatgtggattaaattactaaaggaaaagaaggacgacgattgg
gacattggtaacattgtcttcactttaactaacagaagacatggtgaaaaggttgtatca
tattgtgaatcacacgatcaagcattagttggtgacaagacattagctttctggttgatg
gatgccgctatgtacacggatatgaccgtactcaaagaacttagtttagtcatcgaccgt
ggtatcgctctacataaaatgattagactactaacgcattctttaggtggtgaagcttac
ctaaattttgaaggtaatgaattcggacatccagaatggttagatttcccaaatgttaat
aataatgatagttatcattatgctcgtagacaattcaacttagttgatgaccatttgtta
cgttaccgtcacttaaacgattttgatagagctatgcaattatgtgagaaaaaacatcaa
tggttgaatactcctcaagcttacgtctcattgaagcacgaagttgataaagttattgtc
tttgagcgtaatggcctcttattcattttcaatttccatccaacaaatagtttcacagat
tacagagttggtgttgatcaagctggttgttatagaattgttttgaattctgatcgtgat
gaatttggtggacacgatagaattgatgagagttccaaattctacaccactgatttagaa
tggaacaatagaagaaattttcttcaagtgtacattccaagtagaactgccatagtcctt
gctttagaaaaatag

DBGET integrated database retrieval system