KEGG   Kazachstania africana: KAFR_0H03320Help
Entry
KAFR_0H03320      CDS       T02487                                 

Gene name
KAFR0H03320
Definition
hypothetical protein
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
kaf  Kazachstania africana
Brite
Enzymes [BR:kaf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     KAFR_0H03320 (KAFR0H03320)
Protein phosphatases and associated proteins [BR:kaf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     KAFR_0H03320 (KAFR0H03320)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:633105..635213
Genome map
AA seq 702 aa AA seqDB search
MQSNMTSSAMEGSTKRKQEEENLESLNVVPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRY
HAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVREATA
DEILEVHSREHLEFLESTTTMNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAV
VEGKVKNALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHH
GNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGD
AEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARG
NLVVVLEGGYNLDSIAISALSVAKTLIGEPPDELPDPLKDPKPEALEMIYKVIKIQSKYW
KCFKRRHGNYNINFSEVASDTLATKTFPLQTAIRQQQYYNLFKEYDFVKFPTANLKLPDD
LILCSPNIHTAETVIIIVHDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAHNRKYGI
IDVNIPQSLIYGDENPDNYSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDSVSGVVH
LLGHRDTKERVKAVINFMADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWGDKENKK
PRKKYGRVLRCDTDGLNSTIEERFDEATDFILDSFEEWSDSE
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcaaacatgacttcttcagcgatggaaggctctacgaagaggaagcaagaagag
gaaaatctagaaagtttgaatgtggttcctaagagacaagtgattgtccctacaaagaaa
ccacaagttcattacataccgttgaagacgggtctctgttatgacgtgagaatgagatac
catgcaaagatcttcacgtcatatttcgaatacatagatcctcatccagaggatcctcga
agaatctatcgtatctacaagatcctcgcggaaaacggtctcattaatgatactatgtta
agtggtgttgatgatattggtgatattatgctaaagatccccgtcagggaagccactgct
gatgaaatcctagaagttcattcccgtgaacatttagaatttctggaaagcacaacgaca
atgaatagggaagttttactgaaggaaactgagaaaggtgattccgtatattttaataac
gattcctacatgagcgctaagttatcctgtgggggcgcaatcgaagcttgcaaagctgtt
gttgaaggtaaagtcaagaatgcattggcagtagtcagacctccgggacatcactctgaa
ccagaatcatctggtgggttttgtcttttcagtaacgtagctgttgctgctaaaaatatc
ctaaaaaattatcctgaaagtgtaagaaaaataatgatcttagattgggatattcaccat
ggtaacggtactcaaaaggctttctatcaagatgagagagtcttatacgtttccctgcat
aggttcgaagcaggtaagtactatcctggcacggtccaaggccaatacgaccaatgcggt
gaaggtaaaggtgaaggtttcaattgtaatattacttggcccaccggtggtgttggtgat
gcagaatatatgtgggcatttgaacaaatcgtcatgccaatgggaagagagtttcaacca
gatttggtgattatatcttcaggatttgacgcagctgatggtgatgtcatcggtcagtgt
catgttactccaagttgctatggtcatatgacacatatgttgaagtctttagcaagaggt
aaccttgttgtggttcttgaaggtggttataatttagattctattgcaattagtgcatta
agcgtggccaagacgttgattggtgaaccacctgatgaacttccggacccattgaaggat
cccaaaccagaggccctggaaatgatttataaagttataaaaatccaaagtaaatactgg
aaatgtttcaaacggagacatggtaattataacataaatttcagtgaagtcgctagtgat
acgctcgcaacgaaaactttcccattacaaacagctatacgtcaacagcaatattacaac
cttttcaaagaatatgacttcgttaagtttcccacagcaaaccttaagctaccggatgat
ttgattctttgttctccaaatattcatacagcagaaactgtaataatcatagtccatgat
acgcctcaaatatggcttgaaaaagatataatatcaaatactgttgatccatgttcttcc
ataatcatagactccactctcgattttctcaaatgggcccacaataggaaatacggtata
attgacgtcaatataccgcagtcactaatatacggtgacgaaaatccagataattattcg
tccttgatcaatgctcaagaaattttactcttcctatgggataatcatattaagtttctc
aacgaagtgaacaagattgcatttattggtgttggtgattcagtttcaggcgtggtacac
ttgttaggtcatagagacaccaaggaaagagtaaaagccgtaatcaattttatggctgat
aaacaactgaaaccgctggttccattagtggacgaatcattaagcgattggtactttaag
aattctctggtcttttcaaatagaacacatccttgttggggtgataaagaaaacaaaaaa
ccaagaaagaaatacggtagagtattaaggtgcgatactgatggattgaatagtaccatc
gaggaaagatttgacgaagccactgattttatactggattcttttgaagaatggagcgat
agtgaataa

DBGET integrated database retrieval system