KEGG   Kazachstania africana: KAFR_0I01850Help
Entry
KAFR_0I01850      CDS       T02487                                 

Gene name
KAFR0I01850
Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
kaf  Kazachstania africana
Brite
Enzymes [BR:kaf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     KAFR_0I01850 (KAFR0I01850)
    1.3.1.94  polyprenol reductase
     KAFR_0I01850 (KAFR0I01850)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:378296..379042
Genome map
AA seq 248 aa AA seqDB search
MLSDQSLNYLIYSYRFTVIVGLLSLVVAKYFLTTLLQYGKTFKRHESKNLIEKIVFFTVP
KSYFSHFYMISTVLSIVTLTCYRHFPIVWLILTHSMRRLYETLFVFKETDKSRMHWSHYI
VGLWFYTTIQLVLNIQLGKNNISTDFNKISFILFTLASWDQNKNHMILSRLVKYSLPKGR
LFNYVCCPHYLDEIIIYFSLTLYNIEFSWLLIWVLANLSVSSIETRKYYIQKFSDERVPK
YSIIPCIL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgctatctgatcaatcgctgaattatctaatatatagttacaggtttaccgttatcgtt
ggccttctatcattagtagttgctaaatattttttaactactttgctgcagtatgggaaa
actttcaaacgtcacgaatcaaagaacttaatcgagaaaatagtgttttttaccgtccca
aaatcgtatttttcacatttctacatgatatcaaccgtgctctccattgttactcttacg
tgctaccgtcactttccaatagtttggctgatcttaacccattctatgagaagattatac
gaaaccctgttcgtattcaaagagacggacaagtctcgaatgcattggtctcattacatc
gttggattatggttttacactactatacagttggttttgaacatccaattaggaaaaaac
aatatttcaacagactttaacaagatttcattcattttattcacactagcttcatgggac
caaaataagaatcacatgattttgtcacgacttgtcaagtacagtctacccaagggaagg
ctgttcaattatgtgtgttgccctcattatctcgacgaaataataatttatttctcatta
actttatataacattgaattttcttggctgctcatttgggttctagcaaatttgagtgta
tcatccatcgaaacaaggaaatattacatccaaaagttttctgatgaacgagtaccgaaa
tattctatcatcccatgtatactttag

DBGET integrated database retrieval system