KEGG   Kazachstania africana: KAFR_0I01920Help
Entry
KAFR_0I01920      CDS       T02487                                 

Gene name
KAFR0I01920
Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
kaf  Kazachstania africana
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:kaf00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:complement(391825..392664)
Genome map
AA seq 279 aa AA seqDB search
MLLAIFITICIYQLFNIFDKRKGTKRRSILKKGEFLQFPLVEKTVLTHSTAIYRFGLPDE
NDILGLPIGLHISIKAKIDGKDICRSYTPISLDEEVHGYFELLVKSYENGNISKMIGELQ
IGDTINVTGPLGSYDYEPNCRTKIGMIAGGTGIAPMYQVMKAIANNPHDFTEVSLIYGNV
TEEDILMKMEIDEIVSSRPDQFSVYYLLDKVDRDDWEGGVGYITQDLMEKLLPSPHENGV
QLLLCGPPRMVSSSKKMAVALGYQKSKPVSRMEDQIFIF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgctgctagcaattttcattaccatctgcatttatcaattattcaacatttttgataag
aggaagggaaccaagcgtcgtagtatattgaagaaaggtgaatttttgcaatttccatta
gtggaaaagactgttctaacgcacagcactgctatttatagatttggcctaccagatgag
aatgatattcttggattacccattggattacatatttcaatcaaggcaaagatcgatggt
aaagatatctgtaggtcatatacaccaatttcgttagatgaagaggtgcatggctatttc
gaattgctagttaaatcatatgaaaatggtaacatttctaagatgattggtgagttacaa
atcggagatactattaatgttactggaccattaggttcctacgattatgaaccaaattgt
cgtactaagattggtatgattgccggtgggactggtatcgcaccaatgtatcaggtaatg
aaggcgattgcaaacaatccacatgattttaccgaagtttcattaatttacggtaacgtt
actgaagaagatattttaatgaaaatggaaattgatgagatagtttcctcgagaccagac
caattttctgtttactatcttttagataaagttgatcgggacgattgggaaggtggagtt
ggttacattactcaagatttaatggaaaagttgttaccatcaccacatgaaaatggagtt
cagttattactctgtggacctccaagaatggtttcttcgagcaaaaaaatggctgttgca
cttggttaccagaagtccaagcctgtctccagaatggaagaccaaatcttcattttctaa

DBGET integrated database retrieval system