KEGG   Kazachstania africana: KAFR_0J00110Help
Entry
KAFR_0J00110      CDS       T02487                                 

Gene name
KAFR0J00110
Definition
(RefSeq) hypothetical protein
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
kaf  Kazachstania africana
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KAFR_0J00110 (KAFR0J00110)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KAFR_0J00110 (KAFR0J00110)
   00051 Fructose and mannose metabolism
    KAFR_0J00110 (KAFR0J00110)
   00052 Galactose metabolism
    KAFR_0J00110 (KAFR0J00110)
   00500 Starch and sucrose metabolism
    KAFR_0J00110 (KAFR0J00110)
   00520 Amino sugar and nucleotide sugar metabolism
    KAFR_0J00110 (KAFR0J00110)
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    KAFR_0J00110 (KAFR0J00110)
Enzymes [BR:kaf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     KAFR_0J00110 (KAFR0J00110)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:19884..21344
Genome map
AA seq 486 aa AA seqDB search
MVHLGPKKPPMRKGSMADVPQDLIEAMTEVESSFTVSGEQLRKVVDHFVSELEKGLSKKG
GNIPMIPAWVVKYPTGKEKGDYLAIDLGGTNLRVVLVKLGGDNTFDTTQSKYKLPDHIRT
TQDSEELFRFIAECLEAFVKETYIDGVKGTLPLGFTFSYPASQDKINEGILQRWTKGFDI
PGVEGHDVVGMLQKQMKAKNLPIDVVALINDTTGTLVASLYTDPDTKMGVIFGTGVNGAY
FEQVSDIEKLEGKLSDDIPPSSLMAINCEYGSFDNEHVALPRTKYDIIVDKQSPRPGQQT
FEKMSSGYYLGELLRLTIVDLHDRGLILNHQDMSELNKPYVMDTSYPAKIVEDPFENLED
TDNLLQKDLKVKTTVQERKVIRRIAESIGRRSARISVCGIAAVCQKRGYTSGHIAADGSV
YKMYPNFKEMAHEGLRDIHEWTETDPSKYPIQIVSAEDGSGAGAAVIAALTEERLAKGLS
VGLTGA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggttcatttaggtccaaaaaagccaccaatgagaaagggctccatggctgacgtccca
caagatttaatcgaagcaatgaccgaggttgaaagctcgttcactgtctccggtgaacaa
ttaagaaaagttgttgaccatttcgtcagcgaattagaaaaaggtttatccaagaaaggt
ggtaatattcctatgattccagcttgggttgtcaagtacccaaccggtaaagaaaaggga
gactatttagccattgatctaggtggaactaacttaagagttgtcttagtcaaattaggt
ggtgacaacacattcgacactactcaatccaagtacaaattaccagatcacatcagaact
actcaggactccgaagaattgttcagattcattgctgaatgtttagaggctttcgtcaag
gaaacatacattgacggagttaaaggtaccttaccattaggtttcactttctcctaccca
gcttctcaagacaagattaacgaaggtattttacaaagatggaccaagggcttcgatatt
ccaggtgtcgaaggtcatgatgttgttggaatgttacaaaagcaaatgaaagctaaaaat
cttccaattgacgttgtcgctttaattaacgataccactggtactttagttgcttcttta
tacactgacccagacacaaagatgggtgttattttcggtactggtgtcaatggtgcttat
ttcgaacaagtctctgacattgaaaaattagagggaaaattgagtgatgacataccgcca
agttccttaatggctatcaactgtgaatacggttccttcgataacgaacatgttgcttta
ccaagaactaagtatgatattattgttgacaaacaatctccaagaccaggtcaacaaact
ttcgaaaagatgtcttctggttactatttaggtgaattattaagattaaccattgttgac
ttacatgaccgcggtttaattttaaatcaccaagacatgagtgaattaaacaagccctac
gtcatggatacatcatacccagctaagattgttgaagatccatttgaaaacctagaggat
accgacaatttattacaaaaggacttgaaggtcaagactactgttcaagaacgtaaggtt
atcagacgtattgccgaatctattggtagaagatccgctagaatttctgtttgtggtatt
gctgctgtctgtcagaagagaggttacacttcaggacatattgctgccgatggttctgtc
tacaagatgtatccaaactttaaggaaatggcacatgaaggtttgagagatattcatgag
tggactgaaaccgatccaagcaaatatccaattcaaattgtttcagctgaagatggttca
ggtgctggtgctgctgtcattgctgctttaactgaagaaagattagctaagggattatct
gttggtttaactggtgcttaa

DBGET integrated database retrieval system