KEGG   Kazachstania africana: KAFR_0J00410Help
Entry
KAFR_0J00410      CDS       T02487                                 

Gene name
KAFR0J00410
Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
kaf  Kazachstania africana
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:71944..73995
Genome map
AA seq 683 aa AA seqDB search
MDSVDVIVLLLAAVAVLFYTNRTKLTSIFFGNDDSITVNSSSGDIVTVLKENKKNYLVLY
ASQTGTAEDYAKSFAKELISKFSLNVMCTDVENYEYDNLDTVSVPVSIFISTYGEGDFPD
NAANFESFLNNIESSDLTNLKFTLFGFGNSTYEFYNGAAKRTLKALKSAGATLIGSYGEA
DDGSASTDEDYLSWKSKIFDDLKTSLNLDEQEDIFKPSFKYEVIDEKVNGKVALGEPCQE
YLPRNKLPFSKEKNVFTGPFNANFPYVAPITASRELFQSDDRNCIHAEFDVSGSNLKYST
GDHLAIWPSNANETVEKFLAVFSLNPDEIFNLTPLDATIKLPFPCPTTIGSVVRHYMEIT
GPVSRKFFSSLVQFAPNNEIKERLEELSNDKDQFAVEITSKYYNIADAVSYLSNEKPWTT
IPWTFLIESLARIQPRYYSISSSSLSEKQTIHVTAVVENIPNNKSGNPIIGVTTNLLRNI
QLNQSLNEKISGPSLPCTYDLSGPRNLFEDSKLPVHVRRSHFKLPSNPRTPVIMIGPGTG
VAPFRGFIRERCKMLELQSNLKLGKHLLFYGCRNNDDYLYKDEFPEYIEKMDGLLELFVA
FSRLPGSEKVYAQDMLKENEEQVLSLMKQGAFIYVCGDAKSMAQAVHATLIDILRRGLQI
SAAEATEMLKMFKTTGKYQEDVW
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggattccgttgatgtgattgtgctgctactcgctgcggtcgctgttttgttttatacg
aacaggacaaagcttacttctatcttttttggtaacgacgactcgattaccgttaattcg
tcgtctggtgatattgtgactgtactcaaggaaaacaagaagaattatttggtactgtat
gcttcccaaactggtactgctgaagactatgccaagagtttcgccaaagaattaattagt
aagttctcgttgaatgtgatgtgtaccgatgtcgagaattatgaatacgataacttggat
actgtcagcgtaccagtgtcgattttcatttctacttatggtgaaggtgatttccctgac
aatgccgctaattttgaatcgtttttaaacaatatagagtccagcgacttgaccaatttg
aaatttactctctttgggttcggtaattcgacttacgaattttataatggagctgcaaaa
aggactttaaaggcattaaaaagtgctggagcaactctaattgggagctacggtgaggca
gatgacggttctgcttctactgacgaagattatttgtcatggaaatcaaagatatttgat
gatttgaagacctctttgaatttagatgaacaagaagatattttcaagccttcattcaaa
tatgaagtcatagacgaaaaagttaacggtaaagttgctcttggtgaaccatgccaagag
tatttaccacgcaacaaattacctttcagtaaagagaaaaacgttttcaccggtcctttc
aatgccaactttccttatgtggctccaataactgcatcgagagagttgtttcaaagtgac
gatcgtaactgcattcatgcagaattcgacgtttccggttctaatttaaaatattctacc
ggtgatcatctggctatttggccatcaaatgcaaatgaaactgtcgagaagtttttggcg
gttttcagtctgaatcctgatgaaattttcaatctgactccgctagacgccaccataaag
ttgccattcccatgtccaaccaccatcggttccgttgtaagacattatatggaaataaca
ggcccagtatcgagaaaattctttagttcgttggttcaatttgccccgaacaacgaaatt
aaagagaggctagaagagttatctaacgataaggaccaattcgccgttgaaattacttct
aaatattacaatattgccgacgccgtatcatatttgtctaatgaaaagccatggaccacc
attccgtggacgttcctgattgaatctcttgcgcgtattcaacctcgttactattcgatt
tcatcctcttcactatctgaaaagcagactattcacgtaactgctgtcgtagaaaatatt
ccaaacaataaaagtggtaatccaataattggtgtcacaacaaatttgttacgaaacatt
caattgaatcagagcttaaacgaaaaaatctccggtccatcattaccttgtacttacgat
ttgagtgggccgcgtaatctatttgaagatagtaaactgcctgtccacgttcgccgttct
cacttcaagttgccatccaatcctaggactccagtaattatgattggacctggtactggt
gttgcaccattccgtgggttcattagagaaagatgtaaaatgttggaattacaatctaat
ctcaaattgggtaaacatcttctcttctacggatgtcgtaacaatgatgactatctctat
aaagatgaatttccagaatatattgaaaagatggatgggctgctagaactatttgtagct
ttttcaagattgcctggttccgaaaaggtgtacgctcaggacatgttgaaggagaatgaa
gagcaagtcttgagcctgatgaagcaaggtgcattcatttatgtttgtggtgatgctaag
agtatggcacaggccgttcatgcaaccttgatagatatcttacgccgtggattgcaaatc
tctgctgctgaggcgacagagatgttgaaaatgttcaagaccaccggcaagtaccaggaa
gacgtctggtaa

DBGET integrated database retrieval system