KEGG   Kazachstania africana: KAFR_0K00650Help
Entry
KAFR_0K00650      CDS       T02487                                 

Gene name
KAFR0K00650
Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
kaf  Kazachstania africana
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    KAFR_0K00650 (KAFR0K00650)
Enzymes [BR:kaf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     KAFR_0K00650 (KAFR0K00650)
Glycosyltransferases [BR:kaf01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   KAFR_0K00650 (KAFR0K00650)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11:complement(144289..146541)
Genome map
AA seq 750 aa AA seqDB search
MMSSTTGYGSHEKSPESQLRHRDINAKSELIQEKVNEREDLSKTGKVNPLLRLEAFVMPI
VFTLLALFTRMYRINANSHVVWDEAHFGSFGSYYLKHEFYHDVHPPLGKMLVGFSGYLAG
YNGSFDFASGAEYPDYVDFVKMRIFNASFSAMCVPLAYFTAKAIGFSLPGVWFFTVLVLF
ENTYCTLGRFILLDSMLLCFTVASFFCFVKFHNERKKPFGRKWWKWMCLTGISLGCTISV
KMVGLFVISLVGIYTIVDLWNFLGEKSMPWKTYINHWLARILGLIILPLAVFMWSFYMHF
TLLTNSGSGDAVMSSLYQATLIGSEVGAGPRDVAIGSSIITIKNQKLGGALLHSHYQLYP
TGSQQQQITAYGFKDNNNEWFFDRARGLVNWNETETDDEFVKNGNSYRLVHRGTGRNLHT
HPVLAAMTKSEWEVAGYGDHEIGDLKDNWVIEVIEQKNDEDPDKIHPLTTLFRIRSDVMD
CHLAQTDKSLPEWGFRQGEIVCLRNAHKNDKRTWWNIETHENERLPEAPEDFKFPKPGFL
ESFIHLNRAMMASNNALVTADDKYDPLASSAWEWPTLHTGLRLNHWGDENVKYYLLGTPV
STWGSSIAVLGFMIYVAILILRWQRQYSDLTDSTDLNLFLIGGFYPLLGWGLHFMPFVIM
SRVTYVHHYLPALYFALIIFTYVLEACTKRLLKTKFGRVSRLMIFTTLTLSVTACFAYFA
PISFGMDGPKEQYAYLGWFSNWIIGHDLQL
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcttctactacagggtatggaagccacgaaaagtctccagaaagtcaattgaga
catagagatatcaatgctaaatcagaactgatacaagaaaaagttaacgagagagaagat
ctctcgaaaactggaaaagtgaacccgttgcttcgtttagaagcctttgttatgccgatt
gtttttacattattggcgctattcactagaatgtacaggattaatgccaatagccatgtt
gtttgggatgaagctcatttcggtagttttggttcatattatttaaagcacgaattttac
cacgatgttcaccctccattgggtaagatgttagttggattttcaggttatttagctggg
tacaatggttcatttgatttcgcttccggtgcagaatatccagactatgtcgattttgtt
aagatgagaatcttcaatgcgtcattctctgctatgtgtgttccgttagcatatttcaca
gcaaaggcaatcggattctcattaccaggcgtttggttctttacagtccttgttcttttc
gaaaatacttactgtactttgggtagatttatcttattagattctatgctgttgtgtttc
actgtagcatctttcttctgcttcgttaagtttcataacgaaaggaaaaagccattcgga
agaaaatggtggaaatggatgtgtttgacaggtataagtctaggatgtaccatctcagtg
aaaatggtaggcttatttgtcatttccttggttggtatttacactatcgttgatttatgg
aatttcttaggtgagaaatccatgccatggaaaacttacattaatcattggttagctaga
attttaggtttgatcattttaccacttgcagtctttatgtggtctttctacatgcatttc
actttactaaccaactctggttcaggggacgccgtcatgtcatctttataccaagccact
ttgattggaagtgaagttggtgccggacctcgtgatgttgcaatcggttcctctataatt
actatcaagaaccaaaaattgggtggtgcactattgcattcacattaccaattatatcca
acaggttcccagcaacaacagattaccgcgtatggtttcaaagataataacaatgaatgg
tttttcgatagagcaagaggtttggtgaattggaatgaaactgaaactgatgacgaattt
gttaaaaatggtaattcttacagacttgttcacaggggtactggaagaaatcttcacaca
catcctgttttagctgccatgacaaagagtgaatgggaagttgcaggttatggtgatcat
gaaatcggtgatctcaaagacaattgggtgatagaagtcattgaacaaaagaatgacgaa
gatcctgacaaaatacatccattgactaccttattccgtatcaggagtgacgtaatggat
tgccatctagctcaaactgataaaagtctacctgaatggggtttcagacaaggtgaaatc
gtttgtttgagaaatgcacacaaaaatgacaaaaggacatggtggaacatcgaaactcat
gagaatgaaaggttacctgaggcaccagaggattttaaatttccaaaacctggattttta
gagagttttattcatttaaatagggctatgatggcatctaacaatgccttagtcactgcc
gatgacaagtacgatccgttagcatcctcagcctgggaatggccaaccttacacacaggt
ctcagattgaatcattggggtgatgaaaacgtcaaatattatttgctaggaacccctgta
tcaacatggggatcttccattgcagtgttgggatttatgatttacgttgcaattttgatt
ttaagatggcaaagacaatacagtgatctaacagattcaacagatttgaacttattttta
attggtgggttctacccattactgggttggggattacatttcatgccttttgtcattatg
tcaagagtcacttatgttcatcattacttaccagcattatattttgctctcataatattc
acatatgtacttgaagcatgcacgaagcgcctactgaagaccaagtttggtagagtcagc
agattaatgatctttaccactctaacattgagcgtgactgcttgtttcgcatattttgca
ccaatttcatttggaatggatggcccaaaagaacaatatgcatacttaggctggttttca
aattggataatcggtcatgatttacaattatag

DBGET integrated database retrieval system