KEGG   Kazachstania africana: KAFR_0K00650Help
Entry
KAFR_0K00650      CDS       T02487                                 

Gene name
KAFR0K00650
Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
kaf  Kazachstania africana
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:kaf00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11:complement(144289..146541)
Genome map
AA seq 750 aa AA seqDB search
MMSSTTGYGSHEKSPESQLRHRDINAKSELIQEKVNEREDLSKTGKVNPLLRLEAFVMPI
VFTLLALFTRMYRINANSHVVWDEAHFGSFGSYYLKHEFYHDVHPPLGKMLVGFSGYLAG
YNGSFDFASGAEYPDYVDFVKMRIFNASFSAMCVPLAYFTAKAIGFSLPGVWFFTVLVLF
ENTYCTLGRFILLDSMLLCFTVASFFCFVKFHNERKKPFGRKWWKWMCLTGISLGCTISV
KMVGLFVISLVGIYTIVDLWNFLGEKSMPWKTYINHWLARILGLIILPLAVFMWSFYMHF
TLLTNSGSGDAVMSSLYQATLIGSEVGAGPRDVAIGSSIITIKNQKLGGALLHSHYQLYP
TGSQQQQITAYGFKDNNNEWFFDRARGLVNWNETETDDEFVKNGNSYRLVHRGTGRNLHT
HPVLAAMTKSEWEVAGYGDHEIGDLKDNWVIEVIEQKNDEDPDKIHPLTTLFRIRSDVMD
CHLAQTDKSLPEWGFRQGEIVCLRNAHKNDKRTWWNIETHENERLPEAPEDFKFPKPGFL
ESFIHLNRAMMASNNALVTADDKYDPLASSAWEWPTLHTGLRLNHWGDENVKYYLLGTPV
STWGSSIAVLGFMIYVAILILRWQRQYSDLTDSTDLNLFLIGGFYPLLGWGLHFMPFVIM
SRVTYVHHYLPALYFALIIFTYVLEACTKRLLKTKFGRVSRLMIFTTLTLSVTACFAYFA
PISFGMDGPKEQYAYLGWFSNWIIGHDLQL
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcttctactacagggtatggaagccacgaaaagtctccagaaagtcaattgaga
catagagatatcaatgctaaatcagaactgatacaagaaaaagttaacgagagagaagat
ctctcgaaaactggaaaagtgaacccgttgcttcgtttagaagcctttgttatgccgatt
gtttttacattattggcgctattcactagaatgtacaggattaatgccaatagccatgtt
gtttgggatgaagctcatttcggtagttttggttcatattatttaaagcacgaattttac
cacgatgttcaccctccattgggtaagatgttagttggattttcaggttatttagctggg
tacaatggttcatttgatttcgcttccggtgcagaatatccagactatgtcgattttgtt
aagatgagaatcttcaatgcgtcattctctgctatgtgtgttccgttagcatatttcaca
gcaaaggcaatcggattctcattaccaggcgtttggttctttacagtccttgttcttttc
gaaaatacttactgtactttgggtagatttatcttattagattctatgctgttgtgtttc
actgtagcatctttcttctgcttcgttaagtttcataacgaaaggaaaaagccattcgga
agaaaatggtggaaatggatgtgtttgacaggtataagtctaggatgtaccatctcagtg
aaaatggtaggcttatttgtcatttccttggttggtatttacactatcgttgatttatgg
aatttcttaggtgagaaatccatgccatggaaaacttacattaatcattggttagctaga
attttaggtttgatcattttaccacttgcagtctttatgtggtctttctacatgcatttc
actttactaaccaactctggttcaggggacgccgtcatgtcatctttataccaagccact
ttgattggaagtgaagttggtgccggacctcgtgatgttgcaatcggttcctctataatt
actatcaagaaccaaaaattgggtggtgcactattgcattcacattaccaattatatcca
acaggttcccagcaacaacagattaccgcgtatggtttcaaagataataacaatgaatgg
tttttcgatagagcaagaggtttggtgaattggaatgaaactgaaactgatgacgaattt
gttaaaaatggtaattcttacagacttgttcacaggggtactggaagaaatcttcacaca
catcctgttttagctgccatgacaaagagtgaatgggaagttgcaggttatggtgatcat
gaaatcggtgatctcaaagacaattgggtgatagaagtcattgaacaaaagaatgacgaa
gatcctgacaaaatacatccattgactaccttattccgtatcaggagtgacgtaatggat
tgccatctagctcaaactgataaaagtctacctgaatggggtttcagacaaggtgaaatc
gtttgtttgagaaatgcacacaaaaatgacaaaaggacatggtggaacatcgaaactcat
gagaatgaaaggttacctgaggcaccagaggattttaaatttccaaaacctggattttta
gagagttttattcatttaaatagggctatgatggcatctaacaatgccttagtcactgcc
gatgacaagtacgatccgttagcatcctcagcctgggaatggccaaccttacacacaggt
ctcagattgaatcattggggtgatgaaaacgtcaaatattatttgctaggaacccctgta
tcaacatggggatcttccattgcagtgttgggatttatgatttacgttgcaattttgatt
ttaagatggcaaagacaatacagtgatctaacagattcaacagatttgaacttattttta
attggtgggttctacccattactgggttggggattacatttcatgccttttgtcattatg
tcaagagtcacttatgttcatcattacttaccagcattatattttgctctcataatattc
acatatgtacttgaagcatgcacgaagcgcctactgaagaccaagtttggtagagtcagc
agattaatgatctttaccactctaacattgagcgtgactgcttgtttcgcatattttgca
ccaatttcatttggaatggatggcccaaaagaacaatatgcatacttaggctggttttca
aattggataatcggtcatgatttacaattatag

DBGET integrated database retrieval system