KEGG   Kazachstania africana: KAFR_0K01120Help
Entry
KAFR_0K01120      CDS       T02487                                 

Gene name
KAFR0K01120
Definition
hypothetical protein
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
kaf  Kazachstania africana
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    KAFR_0K01120 (KAFR0K01120)
Enzymes [BR:kaf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     KAFR_0K01120 (KAFR0K01120)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11:233302..235392
Genome map
AA seq 696 aa AA seqDB search
MGKIFAKVLINIGLIPLLLASSTVEKDKFPEPLTKANFEEELSQGLHIVEFYSPYCSHCK
TLAPTWKDTWETFHEEGEKLNIRFSQVDCIESGDLCSEQNIEYFPTIRLYGPGQMIKTYP
SNGKRTKEAFINFARKEALDPSNIDPADWKSQSNLLTDFDMINLLGGKGEKPFLISFWPS
MGMKSTDDATEFLNCEECLAFQRTWKLLSNSLLSSGIATGHFNCLDYETICRELGFSNLA
TQSASREINVPRVALIIPNKESNNLHLYKRPFTLNTDPYEDFATRMAYNSQVPEISLDEL
SQIMKKDLNFERNSKSSVFKQDIHVVFSYNTTTVVPEDFDILEHVFEQVIDIPHAYLHKT
DKNLMDLMRNGYEELYQIINYNNSEPLKILDDNFFALNTITQFPTFFIFKDGDLIANVFP
GYSTTEMRNIDLIMSWIHQYTKPLISELTLSNFEDMLSFERKLYSQLAILFVNTSDTNSI
LESQNGLRSLRLAAYDFEDVRIKSNFEKVLTTRRKKKENVKLLKGKGSKPANIVQAMRQE
IEHDDGSRVLLTYIDINEESNFLRELNPSMENKEPHVGDVVLIDKIHSKLVEKNVNGEFL
STSSPYDIREMMLAVGIPRKSTLSTLFTIPLANDTKKYSSLLGMTGMFAVLFVLAGVVFS
IFTYKLYRRRRIMWNYKTKRNTGGLLGKADKKEFQD
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagatttttgcgaaggttctgatcaacataggcttaataccacttcttttggca
agctcgacagtcgagaaggataaatttccagaaccattgacaaaagcaaattttgaagag
gaattatcacaaggactgcacattgtggagttttacagcccttattgttctcactgtaaa
actctagctccgacgtggaaggatacatgggaaacattccatgaagaaggtgaaaaattg
aatattagattttcccaagtggattgcattgaaagtggtgatttatgttcagaacagaac
attgaatatttcccaacaataagattatacggtccaggtcagatgataaagacttatccc
tcaaatggaaaaagaaccaaagaagctttcataaattttgctagaaaggaagctctagat
ccgtcaaatattgatcctgctgactggaaaagtcaaagtaaccttctaacagatttcgat
atgattaacttgttaggtggtaagggggagaagccatttctaatttctttctggccaagt
atgggaatgaagagtactgatgatgctactgaatttttaaattgtgaagaatgcctggca
tttcaacggacttggaagctgctctcaaatagcttactttcctcaggaatcgcgacagga
catttcaattgtctagattatgaaaccatatgtagggagttaggtttctccaacctagcg
acacaatccgcatctcgagaaattaatgtaccaagagtggccctaatcattcctaataag
gaatcgaataaccttcatttatacaagaggccttttacgttgaacaccgatccatatgaa
gactttgccactagaatggcctacaacagtcaagttcccgaaatatctttggatgagctt
tctcagataatgaaaaaggacctgaattttgagagaaatagcaaatcatctgttttcaag
caagatatccacgtggtattctcttataacaccactacagttgtaccggaagattttgat
attttagaacatgtcttcgagcaggttattgatataccgcatgcgtatcttcataaaact
gacaaaaacctgatggacctgatgaggaatggttacgaagaattatatcaaataatcaat
tataataatagtgagccactaaaaattttggatgataacttcttcgcgttgaataccatc
acccaattcccaacatttttcatttttaaagatggagatttaatagcaaatgtgtttcct
ggctattctactactgagatgaggaatattgatttgattatgtcatggattcatcagtat
acaaaaccattaatttctgaacttacactatcaaattttgaggacatgctttctttcgaa
cgaaaattatacagccagctggcaattcttttcgttaacacatctgatactaacagcatt
cttgaaagtcaaaatggtctcagaagtctaaggctagcagcttatgattttgaagatgtt
aggatcaaaagtaactttgaaaaagtactgactaccagaaggaaaaaaaaagaaaatgtg
aaactattaaaagggaagggttccaaaccggccaatattgtacaagcaatgcgccaagaa
attgagcatgacgatggctcaagagtccttttaacttacatcgacattaatgaagaaagc
aattttctccgagaacttaacccatcaatggagaacaaagagccccatgtgggtgatgtg
gttcttattgacaaaatacatagcaaattggttgagaaaaatgtcaatggagagttttta
tctacttcctctccatatgatatcagagagatgatgttagcggtaggtatacccaggaaa
tccacactctctacactctttacaatcccattggcaaatgacacaaaaaaatattcttct
cttctaggaatgactgggatgttcgctgtgttatttgtactcgctggtgttgtgttctct
atttttacctacaagctttatagacgccgtagaataatgtggaattacaaaactaaaagg
aatacaggcggtttattagggaaggcggacaagaaagaatttcaggattaa

DBGET integrated database retrieval system