KEGG   Kazachstania africana: KAFR_0L00940Help
Entry
KAFR_0L00940      CDS       T02487                                 

Gene name
KAFR0L00940
Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
kaf  Kazachstania africana
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KAFR_0L00940 (KAFR0L00940)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    KAFR_0L00940 (KAFR0L00940)
Enzymes [BR:kaf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     KAFR_0L00940 (KAFR0L00940)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12:complement(173576..175252)
Genome map
AA seq 558 aa AA seqDB search
MSSVTSQGNLEFKEIQSKLENDTRQIEEWWSQSRWANTKRTYSAKDIAVRRGTFPLTNYQ
SSEMSKKLYGILANHHKNATVSRTFGALDPIQITQMSKYLDTIYVSGWQCSSTASTSNEP
GPDLADYPMDTVPNKVDHLFKAQLFHDRKQYEERSQVKTPKDLAQLNGPIDYLTPIIADA
DAGHGGLTAVYKLTKLFIERGAAGIHMEDQTSTNKKCGHMAGRCVIPVQEHINRLITIRM
CADVMNSELIIVARTDSEAATLISSTVDVRDHYFIIGATNPEMKNKPTLVETLHHAILSG
MKGKQVEEIEKKWCEKANLKLFHEAFEDEVNCNPDIKNKRDIIKTFNSKVGPYTGTSLRL
AQKLVKELIGYELYFDWDSPRAREGLYRYKGGTQCAIMRAREFAPYSDLVWMESNYPDYE
QAVEFAKGVKAVYPHQWLAYNLSPSFNWQTAMSINEQATFIDRLGKLGYIWQFITLAGLH
TTALAINNFAHDFAHDGMKAYAQKIQQKEMDENVDVLKHQKWSGAEYIDGLLKLAQGGIS
ATAAMGEGVTEDQFKSKL
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcagttacttctcaaggaaacttagagtttaaagaaattcaatcaaaattggaa
aatgatacaagacaaattgaagaatggtggtcccaatcacgttgggcaaatacgaagaga
acttattcagctaaggatattgcagttagacgtggtacatttccattgacaaattatcaa
tcttctgaaatgtcgaaaaagctgtatggtatcctggccaatcatcataagaatgctact
gtatctagaactttcggagctttagatccaattcaaatcactcaaatgagtaaatatctt
gacacaatttatgtctccggatggcaatgttcatctactgcatctacatcaaatgagcca
ggtccagatttggctgactatccaatggatactgtaccaaataaagttgaccatttattc
aaagcacaattgtttcatgatagaaaacaatatgaagagagatcacaagttaaaacacca
aaagatttggctcaacttaatggtcccattgattatttaactcctattattgcagatgca
gatgcgggtcatggtggtttaaccgctgtgtataaattgacaaaattatttattgaaaga
ggcgccgcaggaattcatatggaagatcaaacgtccactaataagaaatgtggtcatatg
gctggtagatgtgtcatcccggtacaagaacatattaatagactgataacaattagaatg
tgtgctgacgtaatgaattctgaattaatcattgttgctaggacagattcagaagcggcc
actttaataagctctacagtggatgttagagatcattattttataattggtgcaacaaac
cctgaaatgaaaaataaacctactcttgtagaaacattacatcatgcaattttatcaggg
atgaagggtaaacaggtggaagaaattgaaaagaaatggtgtgaaaaggcaaatttgaaa
ctattccatgaagcatttgaagatgaagttaattgtaatccagatatcaaaaataagaga
gatataattaaaacatttaactcgaaagttggtccatacacaggaacatcacttagattg
gcacaaaaattagttaaggaattaataggctacgaactttattttgactgggattctcca
cgtgcaagagaaggcttatatcgttacaaaggaggtacacaatgtgctattatgagagca
agagaatttgcaccatactccgatttagtttggatggaatcaaactaccctgattatgaa
caggctgtagaatttgctaagggggtcaaggcagtttatccacatcaatggttagcatat
aacctctcaccatcgttcaattggcaaacagccatgtccatcaatgaacaagcaaccttt
attgacagactaggcaaattgggatatatctggcaatttattacgttggcaggattacat
accacggcattagcgatcaacaattttgctcatgattttgcacatgatggtatgaaagcg
tatgcacaaaaaattcaacaaaaggaaatggacgagaatgtcgatgtactaaaacatcaa
aaatggtctggtgcagagtatattgatggtttattgaaattagcacaaggtggtataagt
gccacagcagcaatgggtgaaggcgtcaccgaggatcaattcaagagtaaactataa

DBGET integrated database retrieval system