KEGG   Kazachstania africana: KAFR_0L00940Help
Entry
KAFR_0L00940      CDS       T02487                                 

Gene name
KAFR0L00940
Definition
(RefSeq) hypothetical protein
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
kaf  Kazachstania africana
Pathway
kaf00630  Glyoxylate and dicarboxylate metabolism
kaf01100  Metabolic pathways
kaf01110  Biosynthesis of secondary metabolites
kaf01200  Carbon metabolism
Module
kaf_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    KAFR_0L00940 (KAFR0L00940)
Enzymes [BR:kaf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     KAFR_0L00940 (KAFR0L00940)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase Endonuc_Holl
Motif
Other DBs
NCBI-GeneID: 13886910
NCBI-ProteinID: XP_003959837
UniProt: H2B252
Position
12:complement(173576..175252)
Genome map
AA seq 558 aa AA seqDB search
MSSVTSQGNLEFKEIQSKLENDTRQIEEWWSQSRWANTKRTYSAKDIAVRRGTFPLTNYQ
SSEMSKKLYGILANHHKNATVSRTFGALDPIQITQMSKYLDTIYVSGWQCSSTASTSNEP
GPDLADYPMDTVPNKVDHLFKAQLFHDRKQYEERSQVKTPKDLAQLNGPIDYLTPIIADA
DAGHGGLTAVYKLTKLFIERGAAGIHMEDQTSTNKKCGHMAGRCVIPVQEHINRLITIRM
CADVMNSELIIVARTDSEAATLISSTVDVRDHYFIIGATNPEMKNKPTLVETLHHAILSG
MKGKQVEEIEKKWCEKANLKLFHEAFEDEVNCNPDIKNKRDIIKTFNSKVGPYTGTSLRL
AQKLVKELIGYELYFDWDSPRAREGLYRYKGGTQCAIMRAREFAPYSDLVWMESNYPDYE
QAVEFAKGVKAVYPHQWLAYNLSPSFNWQTAMSINEQATFIDRLGKLGYIWQFITLAGLH
TTALAINNFAHDFAHDGMKAYAQKIQQKEMDENVDVLKHQKWSGAEYIDGLLKLAQGGIS
ATAAMGEGVTEDQFKSKL
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcagttacttctcaaggaaacttagagtttaaagaaattcaatcaaaattggaa
aatgatacaagacaaattgaagaatggtggtcccaatcacgttgggcaaatacgaagaga
acttattcagctaaggatattgcagttagacgtggtacatttccattgacaaattatcaa
tcttctgaaatgtcgaaaaagctgtatggtatcctggccaatcatcataagaatgctact
gtatctagaactttcggagctttagatccaattcaaatcactcaaatgagtaaatatctt
gacacaatttatgtctccggatggcaatgttcatctactgcatctacatcaaatgagcca
ggtccagatttggctgactatccaatggatactgtaccaaataaagttgaccatttattc
aaagcacaattgtttcatgatagaaaacaatatgaagagagatcacaagttaaaacacca
aaagatttggctcaacttaatggtcccattgattatttaactcctattattgcagatgca
gatgcgggtcatggtggtttaaccgctgtgtataaattgacaaaattatttattgaaaga
ggcgccgcaggaattcatatggaagatcaaacgtccactaataagaaatgtggtcatatg
gctggtagatgtgtcatcccggtacaagaacatattaatagactgataacaattagaatg
tgtgctgacgtaatgaattctgaattaatcattgttgctaggacagattcagaagcggcc
actttaataagctctacagtggatgttagagatcattattttataattggtgcaacaaac
cctgaaatgaaaaataaacctactcttgtagaaacattacatcatgcaattttatcaggg
atgaagggtaaacaggtggaagaaattgaaaagaaatggtgtgaaaaggcaaatttgaaa
ctattccatgaagcatttgaagatgaagttaattgtaatccagatatcaaaaataagaga
gatataattaaaacatttaactcgaaagttggtccatacacaggaacatcacttagattg
gcacaaaaattagttaaggaattaataggctacgaactttattttgactgggattctcca
cgtgcaagagaaggcttatatcgttacaaaggaggtacacaatgtgctattatgagagca
agagaatttgcaccatactccgatttagtttggatggaatcaaactaccctgattatgaa
caggctgtagaatttgctaagggggtcaaggcagtttatccacatcaatggttagcatat
aacctctcaccatcgttcaattggcaaacagccatgtccatcaatgaacaagcaaccttt
attgacagactaggcaaattgggatatatctggcaatttattacgttggcaggattacat
accacggcattagcgatcaacaattttgctcatgattttgcacatgatggtatgaaagcg
tatgcacaaaaaattcaacaaaaggaaatggacgagaatgtcgatgtactaaaacatcaa
aaatggtctggtgcagagtatattgatggtttattgaaattagcacaaggtggtataagt
gccacagcagcaatgggtgaaggcgtcaccgaggatcaattcaagagtaaactataa

DBGET integrated database retrieval system