KEGG   Kazachstania africana: KAFR_0L01610Help
Entry
KAFR_0L01610      CDS       T02487                                 

Gene name
KAFR0L01610
Definition
hypothetical protein
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
kaf  Kazachstania africana
Brite
Enzymes [BR:kaf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     KAFR_0L01610 (KAFR0L01610)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12:291678..293543
Genome map
AA seq 621 aa AA seqDB search
MKFSAWKLPRDYEKANLLNDNVRFIPNGSDEVETGDGVCLLPRLIKIRYDPLKLLNNFEL
SSSTVQDYLNTDISYLDEELLRPVNEIYYRAVYPYKKDYMIKRTTPTLQDKQFFNDLLIQ
SNLSRFFNANISLTFPQALSKIPKNSKLMIKPIKASNVKYIFINNSEIRTLYPSPFPEHI
NTNQIVHICENCLSYFSSRFTYNRHRVKCQGKKPCGTEIYKDGSLSIFEIDGRIFPKYCK
KLCLLSICFLKSKTLYHEVEPFIFYSLYVDDNFVGYFSKEKLNSTDYNLSCILTLPTFRR
MGYGNLLMEFSYLLSKREFKLGTPEKPLSDLGLVTYRNFWKCKIAEVLIDLRNEFGDSFN
VTLEEIGSLCGFLPTDVIFGLEQLSVLYRRSDSFMIYVDNWTRIEKINERWMNKNRQSLK
VENLIWKPVIFGPTSGVNAVNYNMVEPLSSNIDFDFFNNSISELVNFMSDDIKESRDIEV
TTMEKIREKNGTGEKSAVDIEDGWELCFKDKATLTHPITSAPKRNIPKAVVEELPGLLDE
VIDDRSDEDKPEEAIEDEDEEYKEDEMSGDDVEDEEAEEEDVFEEEEEEEEEEEEEEEEE
REESLPSDTSDSETSFVSFEE
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttagtgcttggaaactgcccagagactacgaaaaggccaatttgttgaacgat
aatgttcgattcataccaaatggcagtgatgaggtggaaacaggcgatggtgtatgcttg
ttaccgagattgatcaaaatacgttatgatccattgaaactattaaataattttgaattg
tcgtcttcaactgtacaagattatctgaacacggatatcagttacttagatgaggaattg
ctgcggcctgtaaatgaaatatattatcgtgcagtatacccttacaagaaagattatatg
ataaaacgtacaacgccaactttacaagataaacaatttttcaatgacctattaatacaa
tcaaacttatcaagattcttcaatgcgaacatatcactcacatttccacaggccctttct
aagattcctaaaaattcaaaactcatgataaaacccattaaggcatcaaacgtaaagtac
atttttatcaataatagcgaaatcaggactctatatccaagtccgttcccagaacatatc
aatacaaaccaaattgtgcatatttgtgaaaattgtttgagctacttctcctcaagattc
acctataacaggcatagggttaaatgtcaaggcaagaagccctgtggaacagagatttat
aaagatggctctttatcaatctttgaaatagatggacgcatattcccaaaatattgtaaa
aaattgtgcctactatcgatttgttttttgaaatcgaaaactctatatcatgaagtggaa
ccgtttatattttattcactttatgtggacgataattttgtaggctacttttcaaaggaa
aaattaaactctacagactataatttaagttgtatactgacactgccgacattcagaaga
atggggtacggtaatctattaatggaattctcatatctattatcaaagagggaattcaag
ttgggcactcctgaaaaaccactgtctgatcttggtttagtaacttacagaaatttctgg
aagtgtaagattgctgaagtactcattgatttaaggaatgagtttggcgattcctttaat
gtaacattagaagaaattggttcgttgtgtgggtttctaccaactgatgtcatatttggt
cttgaacaattgagtgttctatatcgaagaagtgatagtttcatgatatacgtggataac
tggacaagaattgaaaaaataaatgaaaggtggatgaataaaaatcgacagtcattaaaa
gtagaaaacctaatatggaaacccgtaatctttggacctacttctggtgttaatgctgtc
aattacaacatggttgagccgctaagtagtaatattgattttgattttttcaataatagt
atctctgaactagtaaatttcatgagtgacgatattaaagaatcaagagacattgaggtg
acgacgatggaaaagataagggagaaaaatggtaccggtgaaaaatcggcagtggatata
gaggatggatgggagctatgcttcaaagacaaggcaactctgacacatccaataacttcc
gctccaaagagaaacatcccaaaggctgttgtagaagagcttcctggtcttctggatgag
gtgatagatgataggagtgacgaagacaaacccgaggaagcgattgaagatgaggatgaa
gaatacaaggaagatgagatgagcggagacgatgttgaagatgaagaagctgaagaagag
gatgtctttgaagaagaagaagaagaagaagaggaagaagaagaagaagaagaagaagaa
agagaagaatctctgccgagcgataccagtgactctgaaactagttttgtatcatttgaa
gaatag

DBGET integrated database retrieval system