KEGG   Kutzneria albida: KALB_1594Help
Entry
KALB_1594         CDS       T03039                                 

Definition
(GenBank) phosphodiesterase/alkaline phosphatase D
  KO
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
kal  Kutzneria albida
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:kal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KALB_1594
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    KALB_1594
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KALB_1594
Enzymes [BR:kal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     KALB_1594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
UniProt: 
Position
1753136..1754647
Genome map
AA seq 503 aa AA seqDB search
MASLSRRSLLRIGAATAGLFSTAAGFVPSGRPRLTHGVQSGDVTSDGALVWTRADTPSRM
LVEVAGDPSFRHSRLVRGPVLTPDSDGTGRLRLTGLPAGRELHYRVTAEDLDGRLRSEPV
TGSFRTAPLDRRDVRFLWSGDVAGQGWGINPDVGGMRVFSAMADRRPDFFVHSGDTVYSD
GPLQETVVLPDGRRWRNLVTEEKSKVAQTLQQFRGQHSYNRMDDNLRRFTAEVPWIVQWD
DHETMNNWNPGQVLTGHPEYTETRLDVLSARAFQAFHEWHPLDRQRAVDGRVYRNFRYGP
HVELFVLDMRSYRDPNDADTAPYERILGDRQARWLVNALSASRATWKIVAADMPIGLVVA
DARGVEAVANGKPGAPTGREAELAWVFRQLARRHVRNVVWLTADVHYTAAHHYSPERAAV
GDFDPFWEFVSGPLHAGGFGPNVLDPTFGPEAVFVHAPPAANSSPLDDFQHFGEVEVDGH
SGALTVTLRTAAGRSLWATTLRP
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcctccctcagcagacgttcgctgctccgcatcggtgccgccacggcgggtctgttc
agcaccgcggccgggttcgtgcccagcggccgcccccggctcacccacggcgtgcagtcc
ggggatgtcacctcggacggcgcgctggtgtggaccagggcggacacgccctcgcgcatg
ctcgtcgaggtcgcgggcgacccgtccttccggcactcccgcctggtccgcggcccggtg
ctgaccccggacagcgacggcacgggccgcctgcggctgaccggcctgcccgcgggccgc
gagctgcactaccgggtcacggcggaggacctggacggccgcctgcgcagcgagccggtg
accggcagtttccgcaccgccccgctggaccgccgcgacgtgcgcttcctgtggtccggg
gacgtggcggggcagggctggggcatcaaccccgacgtcggcggcatgcgggtgttctcc
gcgatggccgaccgccgccccgacttcttcgtgcacagcggggacaccgtctactccgac
gggccgttgcaggagacggtggtgctgcccgacggccgtcgctggcgcaacctggtcacc
gaggagaagtccaaggtggcgcagaccctccagcagttccgcggccagcactcctacaac
cggatggacgacaacctgcgccggttcaccgccgaggtgccgtggatcgtgcagtgggac
gaccacgagacgatgaacaactggaaccccggccaggtgctgaccgggcacccggagtac
accgagacccggctggacgtgctgtccgcgcgggccttccaggccttccacgagtggcac
ccgctggaccggcagcgcgccgtggacggccgggtctaccgcaacttccggtacggcccg
cacgtggagctgttcgtgctggacatgcgcagctaccgggaccccaacgacgccgacacc
gccccgtacgagcgcatcctcggcgacaggcaggcccgctggctggtcaacgcgctgagc
gcgagccgggccacctggaagatcgtggccgccgacatgcccatcggcctggtcgtggcc
gacgcccgcggcgtggaggccgtggccaacggcaagccgggcgcgccgaccgggcgtgag
gccgaactggcctgggtgttccgccagctcgcccggcgccacgtgcgcaacgtggtgtgg
ctgaccgccgacgtgcactacaccgccgcgcaccactactccccggagcgggccgccgtc
ggcgacttcgacccgttctgggagttcgtgtccggcccgctgcacgcgggcggcttcggc
cccaacgtgctggacccgaccttcgggcccgaggcggtgttcgtgcacgccccgcccgcc
gccaacagctccccgctggacgacttccagcacttcggcgaggtcgaggtggacggccac
tccggggcgctgaccgtcaccctgcgcacggcggcgggccgctcgctgtgggccaccacc
ctgcggccgtga

DBGET integrated database retrieval system