KEGG   Kutzneria albida: KALB_2165Help
Entry
KALB_2165         CDS       T03039                                 

Definition
aminotransferase
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
kal  Kutzneria albida
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:kal00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KALB_2165
   00650 Butanoate metabolism
    KALB_2165
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KALB_2165
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KALB_2165
Enzymes [BR:kal01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     KALB_2165
Amino acid related enzymes [BR:kal01007]
 Aminotransferase (transaminase)
  Class III
   KALB_2165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
2350852..2352156
Genome map
AA seq 434 aa AA seqDB search
MVHEELLARHRAVLPSWLALYYEQPIEIVRGEGRRVTDGEGRTYLDLFAGILTNAIGYDI
AEIREAVRAQLDSGVVHTSTLYLIRQQVELAEKIARLSGIPDAKVFFTNSGTEANETALM
LATQHRRSNQVLALRNSYHGRGFGTIAITGNRGWSASSLSPVNVSYVHGGNRNRGPFKDF
SDAEYIRACVADLREVLATATSGDVACLIAEPIQGVGGFTTPPDGLLGAFKEVLDEFGIL
LISDEVQTGWGRTGEHFWGIQAHGVVPDMMTFAKGLGNGLAIGGLVARGDLMDCLTANSI
STFGGNPVSTAAANATLDYLLDHDLQANAFKVGNQLMDGLRRIAEEEPVIGDVRGKGLMI
GVELVEPGTDEPSSRAAARMMEHTRERGLLIGKGGQGGNVLRLAPPMTLTEAEAEEALGI
LADSIAATSAELAR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggtgcacgaggagctgctcgccaggcacagggccgtgctgccgagctggcttgccctc
tactacgagcagccgatcgagatcgtgcgcggcgagggccgccgggtcaccgacggcgag
ggccgcacctacctggacctgttcgcgggcatcctgaccaacgcgatcggctacgacatc
gccgagatccgcgaggcggtccgcgcccagctcgacagcggggtcgtgcacacctccacc
ctgtacctgatccgccagcaggtggagctggcggagaagatcgcgcgcctgtcgggcatc
ccggacgccaaggtgttcttcaccaactccgggaccgaggccaacgagacggcgctgatg
ctggccacccagcaccgccgcagcaaccaggtgctcgcgctgcgcaactcctaccacggc
aggggtttcggcacgatcgccatcaccggcaaccggggctggtcggcctcctcgctcagc
ccggtcaacgtcagctacgtgcacggcggcaaccgcaaccgcgggccgttcaaggacttc
agcgacgccgagtacatcagggcctgcgtcgcggacctgcgcgaggtgctggccaccgcc
acctccggggacgtggcctgcctgatcgccgagccgatccagggcgtcggcggcttcacc
accccgccggacggcctgctcggcgcgttcaaggaggtgctcgacgagttcggcatcctg
ctgatctccgacgaggtgcagaccggctggggccgtaccggggagcacttctggggcatc
caggcgcacggggtggtgccggacatgatgaccttcgccaagggactgggcaacgggctg
gccatcggcggcctggtcgcccgaggggacctgatggactgcctgaccgccaactccatc
tccaccttcggcggcaacccggtgtccaccgcggcggccaacgccaccctggactacctg
ctcgaccacgacctgcaggccaacgcgttcaaggtgggcaaccagctcatggacgggctg
cgccgcatcgccgaggaggagccggtgatcggggacgtgcgcggcaaggggctgatgatc
ggcgtggagctggtcgagcccggtacggacgagccgagttcgcgggcggcggcacggatg
atggagcacacccgcgagcgcgggctgctgatcggcaagggcgggcagggcggcaacgtg
ctgcgccttgccccgccgatgaccctgaccgaggcggaggccgaggaggcgctgggcatc
ctggccgactcaatcgccgcgacgagcgcggagctggcccgatga

DBGET integrated database retrieval system