KEGG   Kutzneria albida: KALB_2205Help
Entry
KALB_2205         CDS       T03039                                 

Definition
ricin B lectin
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
kal  Kutzneria albida
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kal00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    KALB_2205
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    KALB_2205
Enzymes [BR:kal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     KALB_2205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(2393883..2395718)
Genome map
AA seq 611 aa AA seqDB search
MRSPLLVALLLTASALALPAPAQAAGETVNIWLTSTNDSGGRSLTRGLQQQSPVSFTPGT
GSGGQTVTVNENMTYQQFEGAGASFTDTAAWLMNSSGALSPATREATMRKLFDPVDGIGL
GFVRNPMGASDLARYSYSYDDVPAGQTDPGLARFSIAHDLADVVPLTKQARALNPNLKVM
GSPWTAPGWMKDNDNLVQGWLQSQYYGAYAQYFVKYLQAYAAQGVPVDYVSVQNEPTCCN
GYPSMSWNGSGLAYFTKNDLLPALHSANLSTKVLALDWNWDTYGNYAAATVDDSAVRNDP
LFGGMAWHGYGGNVGQQTTVHDQYPSMNAYDTEHSGGTWIGNQQQEDMNNIIDYTRNWGR
SVVKWSLAVDQNMGPHNGGCGTCTGLITVHNGDSRSGQVDYTVEYYDMGHLTRFVKPGAV
RIDSTDNSAVRNVAWRNPDGSKALVAYNGSGSSQNLRVNWGNQSFSYTLPAATSATFTWS
GSQGSGGATGGRITGVAGKCVDVAGGSSANGTAVQLYDCNGSAAQQWTVSGNTVQALGKC
LDVANASSVNGAQVQLYDCNGTAAQQWTASGGGLRALGKCLDATGNSSANGTRLQLWDCT
GSANQTWTLPI
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
gtgcgatcaccgttgctcgtcgcgctcctgctcaccgcatcagcactggccctgcccgcg
cccgcccaggcggccggtgagaccgtcaacatctggctgaccagcaccaacgactcgggt
ggccgcagcctcacccgtggcctccagcagcagagcccggtgagcttcaccccgggcacc
ggctcgggcggtcagaccgtcaccgtcaacgagaacatgacctaccagcagttcgaggga
gccggtgcctcgttcaccgacaccgcggcctggctgatgaactccagcggggcgctgtcc
ccggccacccgcgaggccaccatgcgtaaactgttcgacccggtcgacggcatcgggctg
ggcttcgtccgcaacccgatgggcgcctcggacctcgcgcggtacagctactcctacgac
gacgtgcccgccgggcagaccgatccggggctggccaggttctccatcgcgcacgacctg
gccgacgtggtgccgctgaccaagcaggcccgcgcgctgaacccgaacctgaaggtcatg
ggctccccgtggaccgcccccggctggatgaaggacaacgacaacctggtgcagggctgg
ctccagtcgcagtactacggcgcctacgcccagtacttcgtgaagtacctccaggcctac
gccgcgcagggcgtgccggtggactacgtgtccgtgcagaacgagccgacctgctgcaac
ggctacccgtccatgtcctggaacggctcgggcctggcctacttcaccaagaacgacctg
ctgcccgcgctgcactcggcgaacctgtccacgaaggtgctcgcgctggactggaactgg
gacacctacggcaactacgccgcggccaccgtggacgactcggccgtgcgcaacgacccg
ctgttcggcggcatggcctggcacggctacggcggcaacgtcgggcagcagaccacggtg
cacgaccagtacccgtcgatgaacgcctacgacaccgagcactccggcggcacctggatc
ggcaaccagcagcaggaggacatgaacaacatcatcgactacacccgcaactggggccgc
agcgtggtgaagtggagcctggcggtggaccagaacatgggcccgcacaacgggggctgc
ggcacctgcaccggtttgatcaccgtgcacaacggggactcgcgcagcgggcaggtcgac
tacaccgtggagtactacgacatgggccacttgaccaggttcgtcaagcccggcgccgtg
cgcatcgactccaccgacaactccgcggtgcgcaacgtggcctggcgcaacccggacggc
tccaaggcgctggtggcctacaacggcagtggcagctcgcagaacctgcgggtcaactgg
ggcaaccagtcgttcagctacaccctgccagcggccacctcggccacgttcacctggagc
ggctcgcagggttcgggcggtgccaccggcgggcggatcaccggcgtcgcgggcaagtgc
gtggacgtggcgggcggcagttccgccaacggcacggccgtgcagctctacgactgcaac
ggcagcgcggcccagcagtggaccgtcagcggcaacaccgtgcaggcactgggcaagtgc
ctggacgtggccaacgccagctccgtcaacggcgcccaggtccagctttacgactgtaac
ggcacggcggcccagcagtggacggccagcggcggcggcttgcgcgcactgggcaagtgc
ctggacgccaccggcaacagctccgccaacggcacacgcctgcaactgtgggactgcacc
ggatccgccaaccagacctggaccctcccgatctga

DBGET integrated database retrieval system