KEGG   Kutzneria albida: KALB_2684Help
Entry
KALB_2684         CDS       T03039                                 

Definition
Alpha-amylase (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
kal  Kutzneria albida
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kal00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KALB_2684
Enzymes [BR:kal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     KALB_2684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
2965993..2967723
Genome map
AA seq 576 aa AA seqDB search
MSSHWRSVALVTALLASVLPAAAAASPPGGGHDVIANLFEWPWTSVAAECGNQLGPKGYG
AVQVSPPEESASVAGHPWWEVYQPVSYQLTSRMGNREQFAAMVSACHAAGVKVYADAVIN
HMAGQASTGYGGSTAPDKYTYPGTYSSADFHHHPDPCPQPDGQIHNYGSQAEVQECELVQ
LADLYTEHDYVRGRIAGYLNDLLSLGVDGFRVDAVKHINPNDIAGIEAKLSKPTYLYQEV
IYGAGEAVQPQQYEGTGDLLEFRYGTNLKAKFASGNLADLNGFGQSWGMEPGNKAVVFVD
NHDTQRNGSTLSYKDGAIYQLATVFGLAWDYGTPTVMSSFDFSGNDQSPPSAANGMVSAV
TCGSGWQCEHRQRWAANMVGLHNAVAGTPVANWWSDGSNQIAFSRGGSGFVAINKEGGTL
SRAFTTGLPAGDYCDVLHGELSGGSCTGPVISVDSSGTARTTVGPMDAIAIHVGARISGA
RVAATFTENANTSWGQNVYVVGSIPALGGWNPANGVPLSSAGYPNWSATVSLPANTSFQY
KYVKRGQDGSTVWESDPNRSASTGSSTALNLADSWR
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcccactggcgcagcgtggcactggtgaccgcactactggcgagcgtcctcccg
gctgccgcggcggccagcccgccgggcgggggccatgacgtgatcgcgaacctgttcgag
tggccgtggacctcggtggcggccgagtgcggcaatcagttgggccccaaggggtacggg
gcggtgcaggtctcgccgccggaggagtccgcgagcgtggcgggccacccgtggtgggag
gtctaccagccggtcagctaccagctgaccagccgcatgggcaaccgggagcagttcgcg
gcgatggtgagcgcctgtcacgcggcgggcgtcaaggtgtacgcggacgcggtgatcaac
cacatggccggtcaggccagcacggggtatgggggcagcaccgccccggacaagtacacc
tacccggggacgtactcctcggcggacttccaccaccacccggacccgtgcccgcagccg
gacgggcagatccacaactacggcagccaggccgaggtccaggagtgcgagctggtgcag
ctggcggacctctacaccgagcacgactacgtgcggggcaggatcgcgggttacctcaac
gacctgctgtcgctgggggtcgacgggttccgggtggacgcggtcaaacacatcaacccc
aacgacatcgcgggcatcgaggcgaagctgtccaagccgacctacctgtaccaggaggtg
atctacggcgcgggcgaggcggtgcagccacagcagtacgaggggaccggcgacctgctg
gagttccgctacggcacgaacctcaaggcgaagttcgccagcggcaacctcgccgacctc
aacgggttcgggcagtcctggggcatggagcccggcaacaaggccgtggtgttcgtggac
aaccacgacacgcagcgcaacggcagcaccctgtcctacaaggacggcgcgatctaccag
ctggcaacggtgttcgggctggcctgggactacggcacgcccaccgtgatgtccagcttc
gacttcagcggcaacgaccagtccccgccgagcgcggccaacggcatggtgtcggcggtc
acctgcggcagcggctggcagtgcgagcaccggcagcgctgggccgcgaacatggtgggc
ttgcacaacgccgtggcgggcacgccggtggccaactggtggtccgacggcagcaaccag
atcgcgttcagccggggcggctccgggttcgtggcgatcaacaaggagggcggcacgctg
tcgcgggccttcaccacggggctgcccgccggtgactactgcgacgtgctgcacggcgag
ctcagcggcggctcctgcaccggtccggtgatcagcgtggattcctcgggcacggcgaga
accacggtcggcccgatggacgcgattgcgatccacgtgggcgcgcgcatttccggggca
cgggtcgcggcgacattcaccgagaacgccaacacctcgtgggggcagaacgtctacgtg
gtcggatcaattccggcattgggcggctggaacccggccaacggcgtcccgctgtcctcg
gccggttatccgaactggtcggcaacggtctcgctgcccgcgaacacctccttccagtac
aagtacgtcaagcgggggcaggatggttcaacggtctgggaatccgatccgaacaggtcc
gcgagcaccggttcctccaccgcgctgaacctggcggacagttggcgctga

DBGET integrated database retrieval system