KEGG   Kutzneria albida: KALB_3002Help
Entry
KALB_3002         CDS       T03039                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
kal  Kutzneria albida
Pathway
kal00250  Alanine, aspartate and glutamate metabolism
kal00280  Valine, leucine and isoleucine degradation
kal00410  beta-Alanine metabolism
kal00640  Propanoate metabolism
kal00650  Butanoate metabolism
kal01100  Metabolic pathways
kal01120  Microbial metabolism in diverse environments
Module
kal_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:kal00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KALB_3002
   00650 Butanoate metabolism
    KALB_3002
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KALB_3002
   00280 Valine, leucine and isoleucine degradation
    KALB_3002
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KALB_3002
Enzymes [BR:kal01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     KALB_3002
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     KALB_3002
Amino acid related enzymes [BR:kal01007]
 Aminotransferase (transaminase)
  Class III
   KALB_3002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AHH96370
UniProt: W5W6H7
Position
3303464..3304801
Genome map
AA seq 445 aa AA seqDB search
MATPTAPTARRLVTEIPGPRSLDAQRRRLDTVAKGVGSVLPVFVESASPGLLHDVDGNTL
IDLGSGIAVTSVGAAAPAVVSAVQEQASRFTHTCFMVTPYEGYVRVCEELAELTPGTHAK
RSALFNSGAEAVENAVKIARHATGRQAVVVFDHAYHGRTNLTMALTAKNMPYKHRFGPFA
PEVYRVPMSYPLRDPQGLTGQQAAARAIDMIDKQVGADNLACVLIEPIQGEGGFVVPAPG
FLPEIARWCAERGVLLVADEIQTGFCRTGTWFACGHEGVVPDLITTAKGIAGGLPLAAVT
GRAEIMDAVHGGGLGGTYGGNPIACAAALATIEVMREQDLCAKAAEIERIALARLRDLAG
RFPVIGEVRGRGAMIAAELVRPGTTEPDADLTARIAKACHARGVVVLTAGTYGNVLRLLP
PLVIPHAVLTEGLDVLAAAFTEVVR
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
gtggcaacgcccaccgcgcccaccgcccgccgactcgtcaccgagatccccggaccgcgt
tcgctggacgcccagcgccgcaggctcgataccgtggccaagggcgtgggcagcgtgctg
cccgtgttcgtggagtcggccagtcccggcctgctgcacgacgtggacggcaacaccctg
atcgacctcggctcgggaatcgcggtcaccagcgtgggcgccgccgcgcccgccgtggtc
tccgccgtgcaggagcaggcatcccgcttcacgcacacctgcttcatggtcacgccctac
gagggctacgtgcgggtgtgcgaggaactggccgagctgaccccgggcacgcacgccaag
cgctccgccctgttcaactccggcgccgaggcggtggagaacgcggtgaagatcgcccgg
cacgccaccgggcggcaggcggtcgtggtgttcgaccacgcctatcacgggcgcaccaac
ctcacgatggcgttgaccgccaagaacatgccgtacaagcaccggttcgggccgttcgcg
ccggaggtctaccgggtgccgatgtcctacccgctgcgggacccgcagggcctgaccggg
cagcaggccgccgcgcgcgccatcgacatgatcgacaagcaggtcggcgcggacaacctg
gcctgcgtgctgatcgagccgatccagggtgagggcggcttcgtggtgcccgcgcccggt
ttcctgccggagatcgcccgctggtgcgccgagcgcggggtgctgctggtggccgacgag
atccagaccggcttctgccgcaccggcacctggttcgcctgcggccacgagggcgtggtg
cccgatctgatcaccaccgccaagggcatcgcgggcggtctgccgctggccgccgtcacc
ggccgcgccgagatcatggacgcggtgcacggcggcgggctgggcggcacctacggcggc
aacccgatcgcgtgcgccgccgcgctggccacgatcgaggtgatgcgcgaacaggacctg
tgcgccaaggccgccgagatcgagcggatcgcgctggcccggctgcgcgacctggccggg
cggttcccggtgatcggcgaggtgcggggccgcggcgcgatgatcgccgcggaactggtc
cggcccggcaccaccgagccggacgccgacctgaccgcccgcatcgcgaaggcctgccac
gccaggggagtcgtcgtgctcaccgcgggcacctacggcaacgtgctgcgcctgctgccg
ccgctggtgatcccgcacgcggtgctcaccgagggcctggacgtgctggccgcggccttc
accgaagtagtcaggtaa

DBGET integrated database retrieval system