KEGG   Kutzneria albida: KALB_5401Help
Entry
KALB_5401         CDS       T03039                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
kal  Kutzneria albida
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:kal00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    KALB_5401
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    KALB_5401
Enzymes [BR:kal01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     KALB_5401
Lipid biosynthesis proteins [BR:kal01004]
 Desaturase
  First
   KALB_5401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
5985820..5986719
Genome map
AA seq 299 aa AA seqDB search
MFAGEQSTARIALVVVFTAVPMLALAAAVPAAWGWGLSWLDIGLAVVFYCLTCLGVTIGF
HRYLTHGAFRANRALRIALAAAGSAAMQGPVVAWVADHRRHHAFADRDGDPHSPWRYGSS
ATALVRGFWHAHMGWLFERDLTNAVRFAPDLLADRDIRRVDRLFPMLTAGTLLAPALVGG
LATMSWWGALTAFFWAGLVRVAVLHHVTWSVNSICHLIGDRPFTARDRSANFWPLAIASM
GESWHNSHHADPTCARHGVRRGQIDISARIIWIFEKCGWATKVRWPAARRVARNLRNTR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgttcgccggcgaacagtccaccgccaggatcgcactggtcgtcgtgttcacggccgtg
ccgatgctggccctggccgccgccgttcccgccgcgtggggctggggcctgagctggctc
gacatcgggcttgccgtggtcttctactgcctgacctgtttgggtgtgaccatcgggttc
caccgctacctgacccacggcgcgttcagggccaaccgcgcactgcggatcgcgctggcc
gccgccggaagtgcggccatgcaaggccccgtcgtcgcctgggtcgccgaccaccgacgc
caccacgccttcgccgaccgggacggtgatccgcattcgccatggcggtacggcagttcc
gccaccgccctggtgcgagggttctggcacgcgcacatggggtggctgttcgagcgagac
ctgaccaacgccgtccggttcgccccggatctgttggcagatcgcgacattcggcgcgtg
gatcggctgttccccatgctcaccgcgggtacgttgctcgcccccgctctcgtcggcggt
ctggccaccatgagttggtggggcgcgctgaccgcgttcttctgggccggtctcgtgcgt
gtcgctgtgctgcaccacgtcacctggtcggtgaactcgatctgccacctgatcggcgac
cggccgttcaccgcacgcgaccgatcggccaacttctggccgctggccatcgcctccatg
ggcgagtcatggcacaactctcaccacgcggacccgacctgcgcgcgtcacggcgtgcgc
cggggacagatcgacatctccgctcgcatcatctggatattcgagaagtgcggctgggcg
accaaagtccgctggccggcggcacggcgcgtcgcccgcaacctgcgcaacacccgatga

DBGET integrated database retrieval system