KEGG   Kutzneria albida: KALB_7484Help
Entry
KALB_7484         CDS       T03039                                 

Definition
hypothetical protein
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
kal  Kutzneria albida
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:kal00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KALB_7484
Enzymes [BR:kal01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     KALB_7484
Glycosyltransferases [BR:kal01003]
 Polysaccharide
  Storage polysaccharide
   KALB_7484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
8460131..8461381
Genome map
AA seq 416 aa AA seqDB search
MRILMLSWEYPPVVVGGLGRHVHALARKLAEQGHEVAVLCRQPTGSDASTHPTTDVLSEG
VRVIRVAEDPPHLVFERDLVAWTLAMGHAMIRAGRELVADWRPEVVHAHDWLVTHPAVAL
AEAAGVPLVATVHATEAGRHSGWLSQPLNQQVHSVEWWLANRADHLITCSAAMRAEVAHL
FDVDPDTVTVLHNGIEPRRWRVRPAEVAQARERHGSPDAPLLLFFGRLEWEKGVQDLIGA
LPRIRRSHPGARLVVAGTGSHAEWLADQARKHRVLRAVEFAGHLSDRELAATLAAADAVV
LPSRYEPFGIVALEAAAAGTPLVASTAGGLGEVVVDGRTGSSFAPGDVDGLTAAVRGVLA
DPAAAQRRARAAKARLGTDFDWGRIAEGTAAVYAAAEVREHAPLGRPKIATGNAFQ
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcctgatgctctcgtgggagtacccaccggtcgtggtcggcgggcttggccga
cacgtgcacgcgctcgcccgcaagctcgcggagcagggccacgaggtcgccgtgctgtgc
cgccagcccaccggcagcgacgcgagtacgcaccccaccaccgacgtgctgtcggagggg
gtgcgggtgatccgcgtcgccgaggacccgccgcacctggtgttcgagcgcgacctggtg
gcctggaccctggccatggggcacgccatgatccgcgccgggcgcgaactggtggcggac
tggcggcccgaggtcgtgcacgcccacgactggctggtcacccatccagccgtggcgctg
gccgaggcggcgggcgtgccgctggtggccaccgtgcacgccaccgaggcgggcaggcac
agcggctggctgtcccagccgctcaaccagcaggtgcactcggtggagtggtggctggcc
aaccgcgccgaccacctgatcacctgctccgcggcgatgcgcgccgaggtggcccacctg
ttcgacgtggacccggacaccgtcaccgtgctgcacaacgggatcgagccgcggcgctgg
cgggtgcgccccgccgaggtcgcgcaggcccgtgagcggcacggcagccccgacgcgccg
ctgctgctgttcttcgggcgcctggagtgggagaagggcgtccaggacctgatcggcgca
ctgcccaggatccggcgcagccaccccggcgcgcggctggtcgtggccggtaccggcagt
cacgccgagtggctggccgaccaggcccgcaagcatcgcgtgctgcgcgccgtggagttc
gcgggtcacctgtccgaccgcgagctggccgccacgctggccgccgccgacgccgtggtg
ctgcccagcaggtacgagccgttcggcatcgtcgcgctggaggccgccgccgcgggcacc
ccactggtggcctccactgcgggcggtctgggcgaggtcgtcgtggacggcaggacgggg
tcctcgttcgcgcccggggacgtggacgggctgaccgccgccgtgcgcggggtgctggcg
gacccggccgccgcgcagcgccgggcccgcgccgcgaaggccaggctgggcaccgacttc
gactggggccgcatcgccgagggcaccgcggccgtctacgccgccgccgaggtgcgcgag
cacgctccgctgggccgccccaagatcgccaccggcaacgccttccagtag

DBGET integrated database retrieval system