KEGG   Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis): CKBE_00191Help
Entry
CKBE_00191        CDS       T02427                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
kbl  Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:kbl00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:kbl00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(196702..197979)
Genome map
AA seq 425 aa AA seqDB search
MASMEELQIIGGSQLEGDVNISGAKNAALPILCAGLLTSETISLSNLPDLNDVSTTIKLL
SKLGSITEKNGPNKVSIMSNKIDNLKAPYELVKTMRASILVLGPLLTRFGEAIVSMPGGC
AIGQRPIDQHIKCLSALGADIRVEHGFVIAKAKKLKGTIVRPDIVTVTGTENIIMAATLA
EGETIIENAACEPEIVDLSNMLIKMGANIKGHGTSRIVINGVDKLYGANHRILPDRIEAG
TFLCALAATGGNIRINGVNPYDMLATIDKIRLSGVSVKQDNGSLLCSMNKKPKSVNIVTC
EYPGLATDMQAQFMALNCVSYGTSMIVENIFENRYLHVQELNRLGADITINGNSATVRGV
DFLSGATVRATDLRASASLVIAGLVAQGKTTIEQIYHLDRGYENIEVKLQKLGANIKRAT
NRNDE
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaatggaagaattacaaatcataggtggctcacaacttgaaggggatgttaac
atctctggcgcaaagaatgctgcattaccaattttatgtgctggattactaacatcagaa
acaatttcactgagtaatttgccggatcttaatgatgtttctacaactatcaagttactt
agtaagcttggatcaataacagaaaagaatggtccaaacaaagtatctataatgtcaaat
aaaatagataatctaaaagctccttacgaactagtgaaaacaatgagggcatctatttta
gttctaggtccgcttttaaccagatttggggaagctattgttagtatgcctggaggatgt
gctataggacagaggcctatagatcagcatataaaatgcttatctgcattaggagctgat
ataagagtagaacatggttttgttattgcaaaagcaaagaaacttaaagggactatagtt
cgtccagatatagtgacagttaccggaacagaaaatatcattatggcagcaactcttgca
gaaggcgaaactattatagaaaatgctgcatgcgaaccagaaatagtagatctgtctaat
atgctaataaaaatgggagctaatataaaaggacacggaacgagtagaatagttataaat
ggagttgacaaattatatggagcaaatcatagaatactaccagataggatagaagcaggt
acttttttgtgcgctctagctgctacaggtggtaatataagaataaatggtgttaatcca
tatgacatgttagctactatagataaaataagactatctggggtttctgtaaaacaagac
aatggtagtttactatgcagcatgaacaagaaaccaaaatctgtaaacattgtcacttgt
gagtatcctggattagcaactgatatgcaagcacaatttatggcgctaaactgtgtatca
tatggaacgtcaatgatagttgaaaatatatttgaaaatagatatcttcatgtacaagaa
ctcaatagattaggagcagatataacaattaatggaaattctgctacagttcgtggggta
gactttctttctggagcaactgtaagagctacggatctaagagcatcagcaagtctagtt
atagctggactggttgctcaaggtaagacaactatagaacaaatctatcatctggatcgc
ggttatgaaaacattgaggtaaaacttcaaaagctaggagctaacattaaacgagctaca
aataggaatgatgaatga

DBGET integrated database retrieval system