KEGG   Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis): CKBE_00204Help
Entry
CKBE_00204        CDS       T02427                                 

Gene name
trpC
Definition
(RefSeq) indole-3-glycerol-phosphate synthase
  KO
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
kbl  Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kbl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CKBE_00204 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CKBE_00204 (trpC)
Enzymes [BR:kbl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CKBE_00204 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(211636..212424)
Genome map
AA seq 262 aa AA seqDB search
MNDILKKIVLAKKEEIIIAKQKNSNSALVEKICEQDPTRGFADAIEKKVQQGLPSVIAEI
KKASPSKGILRKDFDPEKFAITYAKNGATCLSVLTDREFFHGCCEDLLRARSSCNLPILR
KDFVIDPYQVLEARSIGADCILLIVSILDINQLIDLEAIAMELGMDVLVETHTRHEIDAA
LHLKTKLIGINNRNLGSFHTDINNTLNLKEYVPNEKIIITESGFSSKEDIEIMRKSNINA
FLIGEVFMKSTDPGQKLSELIS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatattttaaagaaaattgtactcgcaaaaaaagaagaaataataatagcaaaa
caaaaaaacagcaattccgctcttgttgaaaaaatatgcgaacaagatcctaccaggggt
tttgctgatgcaatagaaaaaaaggttcaacaaggattgccaagcgttatagcagaaata
aaaaaagcatctccatctaaaggaatattaagaaaagattttgatccagaaaaatttgcc
attacctatgccaaaaatggggcaacttgcttatcagtattaactgatagagaatttttc
catggatgttgtgaggacctacttagagctagatcatcctgtaatttaccaattctgcgt
aaagattttgtaatagatccttatcaagttttagaagcacgatcaataggagcagattgt
atattattaatagtatctatacttgatatcaatcaattaatagatctagaagcaattgca
atggaattgggaatggatgtcttggtagaaacgcatacccgacatgaaattgacgcggca
ttacatctaaaaacaaaacttattggaattaataatagaaatctcggtagtttccataca
gacataaataacacattaaatctaaaggaatatgtgccaaacgaaaaaataataattact
gagagtggattctcttcaaaagaagatatagaaataatgagaaaatcaaatataaatgca
ttcttaataggggaagtatttatgaagtctacagacccaggacaaaaattaagcgaacta
atatcttga

DBGET integrated database retrieval system