KEGG   Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis): CKBE_00260Help
Entry
CKBE_00260        CDS       T02427                                 

Definition
4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
kbl  Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:kbl00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
276753..277649
Genome map
AA seq 298 aa AA seqDB search
MDHLYDVKAPAKINIFLHVNERRTDGYHLLQTVFRLIDLQDSLNFSLRNDGIISFEMPNN
NIPNETNLVIKAAKLLKMYTRGSKGAHIFLEKNIPIGGGLGGGSSDAASTLIALNKLWSS
SLNRYDLMKLANYLGADVPFFIFGCNAFASGIGNVLVEIDLPVRSYLIIQPDISISTADI
FSDSILKRDTKHVTIQQFMSSPSYLFGKNDLEDVVFDRYPDVCGTVVFLKQHGFAFKMSG
SGSCFFVEYDNISESILALSKIGNIIKKVYGSFKSIRFRFAGAYMGLIDHPLKYWVTK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtggatcatttatatgatgtgaaggctccagcaaaaataaatatatttttgcatgtaaat
gaacgccgtactgatggttatcatttattacaaactgtttttagattaatagatttgcaa
gatagtctaaattttagcttacgtaatgatggaatcataagttttgagatgcctaataat
aatatccctaatgaaacaaatttggttattaaggcagcaaaattactcaaaatgtacaca
agaggtagcaaaggagcacatattttcctggagaaaaatattccaataggggggggtctt
ggcggaggatctagtgatgcagcaagcactttaattgcattgaataaattatggtcatct
agtcttaatagatatgatttaatgaagttagctaattatttaggtgcagatgtaccattt
tttatatttggatgcaatgcttttgctagtggaataggaaatgtattagttgagattgat
ctgcctgtaagatcatatctcattattcagcctgatattagtataagtactgcagatata
ttttcagattctattttgaaaagagatactaagcatgttacaatacagcagtttatgtct
agtcccagctatttgtttggaaaaaacgatttggaagatgttgtttttgatagatatcct
gatgtttgtggcaccgttgtttttttaaaacaacatggatttgcatttaaaatgtctggc
tctggttcttgttttttcgtagagtatgataatatttcagaatctattttggcattgagt
aaaataggtaatataataaaaaaagtatatggaagctttaagtctatcaggttccgtttt
gctggagcttacatgggtcttatagatcatccattgaagtattgggtcacgaagtaa

DBGET integrated database retrieval system