KEGG   Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis): CKBE_00260Help
Entry
CKBE_00260        CDS       T02427                                 

Definition
(GenBank) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
kbl  Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis)
Pathway
kbl00900  Terpenoid backbone biosynthesis
kbl01100  Metabolic pathways
kbl01110  Biosynthesis of secondary metabolites
kbl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:kbl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CKBE_00260
Enzymes [BR:kbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CKBE_00260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AFZ83449
Position
276753..277649
Genome map
AA seq 298 aa AA seqDB search
MDHLYDVKAPAKINIFLHVNERRTDGYHLLQTVFRLIDLQDSLNFSLRNDGIISFEMPNN
NIPNETNLVIKAAKLLKMYTRGSKGAHIFLEKNIPIGGGLGGGSSDAASTLIALNKLWSS
SLNRYDLMKLANYLGADVPFFIFGCNAFASGIGNVLVEIDLPVRSYLIIQPDISISTADI
FSDSILKRDTKHVTIQQFMSSPSYLFGKNDLEDVVFDRYPDVCGTVVFLKQHGFAFKMSG
SGSCFFVEYDNISESILALSKIGNIIKKVYGSFKSIRFRFAGAYMGLIDHPLKYWVTK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtggatcatttatatgatgtgaaggctccagcaaaaataaatatatttttgcatgtaaat
gaacgccgtactgatggttatcatttattacaaactgtttttagattaatagatttgcaa
gatagtctaaattttagcttacgtaatgatggaatcataagttttgagatgcctaataat
aatatccctaatgaaacaaatttggttattaaggcagcaaaattactcaaaatgtacaca
agaggtagcaaaggagcacatattttcctggagaaaaatattccaataggggggggtctt
ggcggaggatctagtgatgcagcaagcactttaattgcattgaataaattatggtcatct
agtcttaatagatatgatttaatgaagttagctaattatttaggtgcagatgtaccattt
tttatatttggatgcaatgcttttgctagtggaataggaaatgtattagttgagattgat
ctgcctgtaagatcatatctcattattcagcctgatattagtataagtactgcagatata
ttttcagattctattttgaaaagagatactaagcatgttacaatacagcagtttatgtct
agtcccagctatttgtttggaaaaaacgatttggaagatgttgtttttgatagatatcct
gatgtttgtggcaccgttgtttttttaaaacaacatggatttgcatttaaaatgtctggc
tctggttcttgttttttcgtagagtatgataatatttcagaatctattttggcattgagt
aaaataggtaatataataaaaaaagtatatggaagctttaagtctatcaggttccgtttt
gctggagcttacatgggtcttatagatcatccattgaagtattgggtcacgaagtaa

DBGET integrated database retrieval system