KEGG   Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis): CKBE_00333Help
Entry
CKBE_00333        CDS       T02427                                 

Definition
aspartate carbamoyltransferase 2
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
kbl  Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kbl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CKBE_00333
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CKBE_00333
Enzymes [BR:kbl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     CKBE_00333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
368958..370229
Genome map
AA seq 423 aa AA seqDB search
MVISQQEFLFSVIKRLDITKNILAAKIGVSLHTLNLWLLPEDSVEFVPMPNEIEEFIYKQ
LLCNISKSKKYSLRDNIALNGKNHLLSVDQFDRESLENFFRVADLMKPISRRQKISRILE
GAVLGNLFFEASTRTRVSFGTAFCRLGGSVCDTTGFTFSSMAKGESIYDTSRVIGGYVDI
MVVRHPEQGSVAEFSRATNIPVVNGGDGPGEHPSQALLDLYTIRTEFSRLGKSIDGSCVV
MIGDLKYGRTVHSLLKLLSLYKGLKISLFSPPGLEMPDSIINYASVNGNCVDIKSSLEEG
LDGVDVVYATRVQKERFTNPMNEYFDKKFQIDLSKINSNCKKDTIVMHPLPRDGRPGAND
LSIDLNNDSRLAIFRQADNGIPIRMAIFAILLGVDHLVNNSLRDVQWSLPAYIGSDDSPF
YCL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggttatttcccaacaagaattcctattttctgttattaaaagattggatattactaaa
aatattcttgctgctaagataggagttagtttgcacacactaaatttatggctattgcca
gaagattcggtagaatttgtgcccatgccaaatgagatagaagagtttatttataagcaa
ttattatgcaatataagcaaaagtaaaaaatattccttaagggataatattgctctaaat
ggtaaaaatcatcttttatcagtggatcaatttgacagagagtcattagaaaattttttt
cgagtagctgatttgatgaagcctatttctcgccgacaaaaaatatcaaggattttagag
ggggcagtcttaggtaatttattttttgaggctagtactcgtactagagttagttttgga
actgctttttgtcgtttaggtggatctgtttgtgataccactggttttacattttcttct
atggccaaaggagaatctatctatgatacaagtagggttattggtggttatgttgacata
atggttgttcgtcaccctgaacagggatcggttgctgaattttctcgcgctacaaatata
ccagtagttaacggtggggatgggcctggtgaacatcctagtcaggctttattagatctc
tatactatacgcacagaattttctagattaggaaagagtattgatgggtcttgtgtagtg
atgattggcgatttgaaatatggtcgtactgtccattctttgctaaaactcctttctttg
tacaaagggttaaaaatttcattattttctccacctggtctcgaaatgcctgatagtata
atcaactatgcctctgttaatggtaattgtgttgatataaaatcctcattagaagaaggt
ttagatggagttgatgttgtttatgctactcgtgttcaaaaagagcgatttacaaatcca
atgaatgaatattttgataaaaaatttcaaatagatctttctaaaataaattctaattgt
aaaaaggatactattgttatgcatcctttacctcgtgatggtcgtcctggggctaatgat
ctgagcattgatttaaataatgacagtcgcttggcaatatttcgtcaggctgataatggg
attcccataagaatggcaatatttgccatattactaggggtggatcacttggttaataat
tcattacgcgatgtacagtggtctttacctgcttacattgggtctgacgattctcctttc
tattgtttgtaa

DBGET integrated database retrieval system