KEGG   Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis): CKBE_00333Help
Entry
CKBE_00333        CDS       T02427                                 

Definition
aspartate carbamoyltransferase 2
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
kbl  Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:kbl00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:kbl00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
368958..370229
Genome map
AA seq 423 aa AA seqDB search
MVISQQEFLFSVIKRLDITKNILAAKIGVSLHTLNLWLLPEDSVEFVPMPNEIEEFIYKQ
LLCNISKSKKYSLRDNIALNGKNHLLSVDQFDRESLENFFRVADLMKPISRRQKISRILE
GAVLGNLFFEASTRTRVSFGTAFCRLGGSVCDTTGFTFSSMAKGESIYDTSRVIGGYVDI
MVVRHPEQGSVAEFSRATNIPVVNGGDGPGEHPSQALLDLYTIRTEFSRLGKSIDGSCVV
MIGDLKYGRTVHSLLKLLSLYKGLKISLFSPPGLEMPDSIINYASVNGNCVDIKSSLEEG
LDGVDVVYATRVQKERFTNPMNEYFDKKFQIDLSKINSNCKKDTIVMHPLPRDGRPGAND
LSIDLNNDSRLAIFRQADNGIPIRMAIFAILLGVDHLVNNSLRDVQWSLPAYIGSDDSPF
YCL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggttatttcccaacaagaattcctattttctgttattaaaagattggatattactaaa
aatattcttgctgctaagataggagttagtttgcacacactaaatttatggctattgcca
gaagattcggtagaatttgtgcccatgccaaatgagatagaagagtttatttataagcaa
ttattatgcaatataagcaaaagtaaaaaatattccttaagggataatattgctctaaat
ggtaaaaatcatcttttatcagtggatcaatttgacagagagtcattagaaaattttttt
cgagtagctgatttgatgaagcctatttctcgccgacaaaaaatatcaaggattttagag
ggggcagtcttaggtaatttattttttgaggctagtactcgtactagagttagttttgga
actgctttttgtcgtttaggtggatctgtttgtgataccactggttttacattttcttct
atggccaaaggagaatctatctatgatacaagtagggttattggtggttatgttgacata
atggttgttcgtcaccctgaacagggatcggttgctgaattttctcgcgctacaaatata
ccagtagttaacggtggggatgggcctggtgaacatcctagtcaggctttattagatctc
tatactatacgcacagaattttctagattaggaaagagtattgatgggtcttgtgtagtg
atgattggcgatttgaaatatggtcgtactgtccattctttgctaaaactcctttctttg
tacaaagggttaaaaatttcattattttctccacctggtctcgaaatgcctgatagtata
atcaactatgcctctgttaatggtaattgtgttgatataaaatcctcattagaagaaggt
ttagatggagttgatgttgtttatgctactcgtgttcaaaaagagcgatttacaaatcca
atgaatgaatattttgataaaaaatttcaaatagatctttctaaaataaattctaattgt
aaaaaggatactattgttatgcatcctttacctcgtgatggtcgtcctggggctaatgat
ctgagcattgatttaaataatgacagtcgcttggcaatatttcgtcaggctgataatggg
attcccataagaatggcaatatttgccatattactaggggtggatcacttggttaataat
tcattacgcgatgtacagtggtctttacctgcttacattgggtctgacgattctcctttc
tattgtttgtaa

DBGET integrated database retrieval system