KEGG   Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis): CKBE_00339Help
Entry
CKBE_00339        CDS       T02427                                 

Definition
(GenBank) hypothetical protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
kbl  Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis)
Pathway
kbl00860  Porphyrin and chlorophyll metabolism
kbl01100  Metabolic pathways
kbl01110  Biosynthesis of secondary metabolites
kbl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CKBE_00339
Enzymes [BR:kbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CKBE_00339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AFZ83528
Position
375360..376154
Genome map
AA seq 264 aa AA seqDB search
MLAQKVFILTRPNSNKILSDSLNDAGFETLSLPSLKIKPFDLKDVPFPGIYDFIFFSSGN
AVRCYLILLNKIYGTIEWPSSTIVVTVGVATANSFRSSDLINIGSLTVLSPNSSALQIDS
ESLWDVLKRQCLHGKRFLFVRGSTGRDWLINKVSEYCEVDLCSVYFRDNVEWSCYDSGRL
KVISERSAITVWLFTSIESIEATIRNIVLLNLEDWFSSCRFIVTHQRIYNFLSSYFIKCI
GFNKVVIKECLPYDESIIMACKSI
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgttagctcaaaaagtttttattctaacaagaccgaatagtaataaaatactatccgat
agtcttaacgatgctggttttgaaactttatctcttccttctttaaaaattaaacctttt
gatctaaaggatgtaccctttccagggatttatgattttatttttttttcaagtggcaat
gctgttagatgttatctaattctgttaaataagatttatggaaccatagaatggccttca
agcacgatagttgttacggtgggggttgcaactgctaatagttttcgttcctctgattta
attaatattggctcattgacagtattgagtccaaattcttctgctttgcagattgattct
gaatcattgtgggatgttttaaaaagacagtgtttgcatggcaaaagatttctttttgtt
agaggatcaacaggtagagattggcttattaacaaagtttctgagtattgtgaggtggat
ttgtgttctgtgtattttagagataatgtagaatggtcttgttatgattcagggagatta
aaagtcatatcagaaagatctgctataactgtatggcttttcactagtatagagagtatt
gaggcaactatcagaaatatagttcttttgaatcttgaagattggtttagtagttgtaga
tttatagttacacatcagagaatttacaattttctatctagttattttatcaaatgtatt
ggttttaacaaagttgtgataaaagagtgtttgccttatgacgagtctattattatggca
tgtaagagtatttaa

DBGET integrated database retrieval system