KEGG   Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis): CKBE_00339Help
Entry
CKBE_00339        CDS       T02427                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
kbl  Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CKBE_00339
Enzymes [BR:kbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CKBE_00339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
375360..376154
Genome map
AA seq 264 aa AA seqDB search
MLAQKVFILTRPNSNKILSDSLNDAGFETLSLPSLKIKPFDLKDVPFPGIYDFIFFSSGN
AVRCYLILLNKIYGTIEWPSSTIVVTVGVATANSFRSSDLINIGSLTVLSPNSSALQIDS
ESLWDVLKRQCLHGKRFLFVRGSTGRDWLINKVSEYCEVDLCSVYFRDNVEWSCYDSGRL
KVISERSAITVWLFTSIESIEATIRNIVLLNLEDWFSSCRFIVTHQRIYNFLSSYFIKCI
GFNKVVIKECLPYDESIIMACKSI
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgttagctcaaaaagtttttattctaacaagaccgaatagtaataaaatactatccgat
agtcttaacgatgctggttttgaaactttatctcttccttctttaaaaattaaacctttt
gatctaaaggatgtaccctttccagggatttatgattttatttttttttcaagtggcaat
gctgttagatgttatctaattctgttaaataagatttatggaaccatagaatggccttca
agcacgatagttgttacggtgggggttgcaactgctaatagttttcgttcctctgattta
attaatattggctcattgacagtattgagtccaaattcttctgctttgcagattgattct
gaatcattgtgggatgttttaaaaagacagtgtttgcatggcaaaagatttctttttgtt
agaggatcaacaggtagagattggcttattaacaaagtttctgagtattgtgaggtggat
ttgtgttctgtgtattttagagataatgtagaatggtcttgttatgattcagggagatta
aaagtcatatcagaaagatctgctataactgtatggcttttcactagtatagagagtatt
gaggcaactatcagaaatatagttcttttgaatcttgaagattggtttagtagttgtaga
tttatagttacacatcagagaatttacaattttctatctagttattttatcaaatgtatt
ggttttaacaaagttgtgataaaagagtgtttgccttatgacgagtctattattatggca
tgtaagagtatttaa

DBGET integrated database retrieval system