KEGG   Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis): CKBE_00423Help
Entry
CKBE_00423        CDS       T02427                                 

Definition
pyruvate dehydrogenase E2 component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
kbl  Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:kbl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:kbl00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:kbl00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:kbl00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
463351..464601
Genome map
AA seq 416 aa AA seqDB search
MPDVGDSKDFEVIEIMVSVGDKVCVEQSLITVESEKASMEVPSTVEGIVRSIIVKIGDKI
SENSPILSLEVETINDLNVSNNSFIDSKSKYKPSKHSDEILENSNSYTQNITIPNEDISV
YASPSIRKLARDLGIDISLVIGTGKKGRILREDINKFIRNKLLKDSSNNLNKSSYNVPSI
DFSKFGDINIKALSRIGKISASKLHSNWVNIPHVTNNDEADITDLELFRKKINEENSNEG
NNTKLTLLPFIVKAVISSLKKFKNINSSLDGDNIVLKNYYNIGIAVDTDHGLVVPVIRNA
DKKGLFELSADIVSLSKKARSGSLLPAEMQGGCFSISSLGGIGGTSFTPIINAPEVAILG
ISKAFIKPIWDGKQFIPKLIMPISLSYDHRVIDGALAARFNVYLCNLLNDFRRVFL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgccagatgttggtgattctaaagattttgaagtaattgagataatggtttcagttgga
gataaagtttgtgtagaacaaagcttgataacagttgaatcagaaaaagcttcaatggaa
gttccttctacagtggaaggtatagttaggtctattattgtaaagattggagataaaata
tcagagaattctcctattttgtcgttggaggttgaaacaatcaatgatttaaatgtttct
aataacagttttattgatagtaaaagtaaatataaaccaagtaagcattcagatgaaatt
cttgagaatagtaatagttatactcaaaatattactattcctaatgaagatattagtgtt
tacgcatctccttccattagaaaattagctagagatcttggcatcgatatatcattggta
attggaacaggaaaaaaaggtcgtatactacgtgaagatattaataaatttataaggaat
aaacttcttaaagatagttctaataatctcaacaaaagctcttacaatgttcctagtatt
gatttttcaaaatttggtgatataaatattaaagcattgagtcgcattggaaaaatttct
gcctcaaaattacatagcaattgggttaacataccacatgttactaataatgatgaagca
gatataactgatcttgaattattccgtaaaaagataaatgaggaaaattccaatgaaggt
aataatacaaagcttacgttgcttccatttatagtaaaagcagttatttcctcattaaaa
aaattcaaaaatataaactcatctctggatggggataatattgtactaaaaaattactat
aatatagggatagcggtcgatactgatcatgggttagttgttcctgtaattcggaatgca
gataaaaaagggttgtttgagctatctgcagatattgtttcattatcaaaaaaagctcgt
agtgggtcgttattaccagcagaaatgcaaggtggttgtttctccatatcttctttaggt
gggattggaggaacttcatttactccaataattaatgcgcctgaggtggctatacttggt
atttctaaagcttttattaaaccaatatgggatggaaagcagtttattccaaagttaata
atgccaatatcattatcctatgatcatagagttattgatggagcactagctgctaggttt
aatgtttatttatgtaatctcctgaatgactttcgtcgtgtgtttttgtaa

DBGET integrated database retrieval system