KEGG   Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis): CKBE_00423Help
Entry
CKBE_00423        CDS       T02427                                 

Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
kbl  Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis)
Pathway
kbl00010  Glycolysis / Gluconeogenesis
kbl00020  Citrate cycle (TCA cycle)
kbl00620  Pyruvate metabolism
kbl01100  Metabolic pathways
kbl01110  Biosynthesis of secondary metabolites
kbl01120  Microbial metabolism in diverse environments
kbl01130  Biosynthesis of antibiotics
kbl01200  Carbon metabolism
Module
kbl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kbl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKBE_00423
   00020 Citrate cycle (TCA cycle)
    CKBE_00423
   00620 Pyruvate metabolism
    CKBE_00423
Enzymes [BR:kbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CKBE_00423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H DUF5097 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AFZ83612
Position
463351..464601
Genome map
AA seq 416 aa AA seqDB search
MPDVGDSKDFEVIEIMVSVGDKVCVEQSLITVESEKASMEVPSTVEGIVRSIIVKIGDKI
SENSPILSLEVETINDLNVSNNSFIDSKSKYKPSKHSDEILENSNSYTQNITIPNEDISV
YASPSIRKLARDLGIDISLVIGTGKKGRILREDINKFIRNKLLKDSSNNLNKSSYNVPSI
DFSKFGDINIKALSRIGKISASKLHSNWVNIPHVTNNDEADITDLELFRKKINEENSNEG
NNTKLTLLPFIVKAVISSLKKFKNINSSLDGDNIVLKNYYNIGIAVDTDHGLVVPVIRNA
DKKGLFELSADIVSLSKKARSGSLLPAEMQGGCFSISSLGGIGGTSFTPIINAPEVAILG
ISKAFIKPIWDGKQFIPKLIMPISLSYDHRVIDGALAARFNVYLCNLLNDFRRVFL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgccagatgttggtgattctaaagattttgaagtaattgagataatggtttcagttgga
gataaagtttgtgtagaacaaagcttgataacagttgaatcagaaaaagcttcaatggaa
gttccttctacagtggaaggtatagttaggtctattattgtaaagattggagataaaata
tcagagaattctcctattttgtcgttggaggttgaaacaatcaatgatttaaatgtttct
aataacagttttattgatagtaaaagtaaatataaaccaagtaagcattcagatgaaatt
cttgagaatagtaatagttatactcaaaatattactattcctaatgaagatattagtgtt
tacgcatctccttccattagaaaattagctagagatcttggcatcgatatatcattggta
attggaacaggaaaaaaaggtcgtatactacgtgaagatattaataaatttataaggaat
aaacttcttaaagatagttctaataatctcaacaaaagctcttacaatgttcctagtatt
gatttttcaaaatttggtgatataaatattaaagcattgagtcgcattggaaaaatttct
gcctcaaaattacatagcaattgggttaacataccacatgttactaataatgatgaagca
gatataactgatcttgaattattccgtaaaaagataaatgaggaaaattccaatgaaggt
aataatacaaagcttacgttgcttccatttatagtaaaagcagttatttcctcattaaaa
aaattcaaaaatataaactcatctctggatggggataatattgtactaaaaaattactat
aatatagggatagcggtcgatactgatcatgggttagttgttcctgtaattcggaatgca
gataaaaaagggttgtttgagctatctgcagatattgtttcattatcaaaaaaagctcgt
agtgggtcgttattaccagcagaaatgcaaggtggttgtttctccatatcttctttaggt
gggattggaggaacttcatttactccaataattaatgcgcctgaggtggctatacttggt
atttctaaagcttttattaaaccaatatgggatggaaagcagtttattccaaagttaata
atgccaatatcattatcctatgatcatagagttattgatggagcactagctgctaggttt
aatgtttatttatgtaatctcctgaatgactttcgtcgtgtgtttttgtaa

DBGET integrated database retrieval system