KEGG   Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis): CKBE_00446Help
Entry
CKBE_00446        CDS       T02427                                 

Definition
1-deoxy-D-xylulose-5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
kbl  Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kbl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CKBE_00446
Enzymes [BR:kbl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CKBE_00446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
490425..491627
Genome map
AA seq 400 aa AA seqDB search
MSALRRVFIFGSTGSIGKKTLEIIDAFHGEIEVFGLSAYSKIDDLVAQAIKYKVKVVVVP
NVRAKEHFYEKWIDKNSIPKLLLGPESLVDMAYDTSYDTVIAAIVGIAGLASALAAAKSG
KRILLANKEVLVVAGSLFMQYVADNNAEIIPIDSEHNAIFQCLCDNNIGIDFKKIENTIR
RIVLTASGGPFRTHDLERLQAITPEQACLHPSWDMGRKISVDSSTMINKGFEVIETHWLF
HIPIKKIEIIIHPQSIIHSMVEYIDGSILAQLSKPDMGIPISYALGFPNRTKNEVGFIDF
IDLRKLEFYPPDFVKFPCLSLALEALKLGQAHCIVLNAANEVAVESFLNGTIKYINIPKI
IENSIEWYEQKIPYLLNNLDDILHLDMISRSFAYKICHEE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgcgttacgtcgcgtttttatttttgggtctactggatcaattggtaaaaaaacc
cttgagattattgatgcatttcacggagagattgaggtttttggtcttagtgcttatagc
aaaatagatgatttagttgctcaagctattaaatataaagtcaaggttgttgtcgttcct
aatgttagagccaaggaacatttttatgaaaaatggattgataagaattctattccaaag
ctgttattaggccctgaatctcttgtagacatggcttatgatactagctatgacacagtt
attgctgcaattgtaggtatagctggtttagcatctgctttggcagcagctaaatctggg
aaacgtattttattagcaaataaagaagttttagtggtagcaggaagcctctttatgcaa
tatgttgctgataataatgcagaaataattcctatagatagtgagcataatgctattttc
caatgtttatgtgataacaacattggaattgattttaaaaaaatagaaaatactattaga
cgtatagtattaactgcttccggtggcccatttcgtacgcatgacctagaaagattgcaa
gctataactccagaacaggcatgtttacatccaagttgggatatgggtcgtaaaatatct
gtagattcatcaaccatgataaataaggggtttgaggttattgagacacattggctattt
catattccaataaaaaaaattgaaataataatacatccacaaagtataatacattctatg
gttgaatatattgatggatcaatattagcgcaattaagcaaacctgatatgggtattcct
atatcttatgctttaggttttccaaatagaacaaaaaatgaagtgggttttatagatttt
atagatcttagaaaacttgagttttatcctcctgattttgtaaaatttccatgtttatcc
ttagctcttgaagctttaaaattaggacaagctcattgtatcgttctaaatgctgctaat
gaagtagcagtagagtcttttcttaatggaaccataaaatatataaacattccaaagata
atagaaaattctatagagtggtatgaacaaaaaattccttatctcttaaacaatctagat
gatatattgcatttagatatgatttctcgtagttttgcgtataagatctgtcatgaagaa
tga

DBGET integrated database retrieval system