KEGG   Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis): CKBE_00554Help
Entry
CKBE_00554        CDS       T02427                                 

Gene name
odhB
Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
kbl  Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kbl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CKBE_00554 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CKBE_00554 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    CKBE_00554 (odhB)
Enzymes [BR:kbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CKBE_00554 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(615064..616263)
Genome map
AA seq 399 aa AA seqDB search
MAIQEVVVPQLSESVSEATMLSWKKSVGAFVESGEILIEIETDKVVLEVPAPSSGILVEI
VMGDNSTVVSGELIAKIDTDAKPSVTDSKPSKQIQSTVNSDKIQNKDLKGVASPSASKIL
SEKGIEPSTVNGTGRDGRITKSDALISDKKTSSKTEEFAPSSLSLDGRSEQRVPMSRLRA
RIAERLIQSQQENAILTTFNEVNMQSVIDIRKQYKDKFEKEHGVKLGFMSFFVKAAVSAL
KKYPLINASIDGKDIIYHGYFDIGIAVGSPRGLVVPILRDADQLSIADIEKSIVDFGKRA
ADGKLSIEEMIGGTFSISNGGVFGSMLSTPIINPPQSAILGIHATKERAIVENGQIVIRP
MNYLALSYDHRIIDGREAVLGLVAIKDALEDPQRLLLDL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggctattcaagaagtagttgtaccccagttgtctgagtctgtctcagaagctactatg
ttgtcctggaaaaagtcagttggtgcttttgttgaatctggtgagattttaattgaaatt
gaaacagataaagttgtcctagaagttccagctccttcctcaggtattttggtagagata
gtgatgggtgataatagtacagttgtttctggcgaattaattgcaaagatagacacagat
gcgaaaccatctgtcactgattcaaaaccaagtaagcaaattcaaagtactgttaattct
gataagattcagaataaagatttgaaaggggttgcttcaccatcagcctcaaaaattttg
tcagagaaaggtatagagccttctactgtaaatggcactggaagggatggtcgcataaca
aaatctgatgctttgatatctgataaaaaaacatcatcaaagacagaggaatttgcaccg
tcctcactgtcattagatggacgttctgagcaacgcgtgcctatgagtagattgcgcgct
cgtattgctgaacgtcttattcagtctcaacaagaaaatgctattctgactacattcaat
gaagtcaatatgcaatctgttatagatattaggaaacagtataaggataagtttgaaaag
gaacatggtgttaagcttggcttcatgtctttctttgttaaagctgccgtttctgcattg
aagaaatatcctttgataaatgcttccatagatggtaaagatataatatatcatgggtat
tttgatataggtatagctgtcggcagtcctagaggacttgtggttcctatacttcgtgat
gcagatcagctatctattgccgatatagaaaaatctattgttgattttgggaaacgagca
gcagatggtaaacttagcatagaagaaatgattggtggaactttttctatatcaaatggt
ggagtgtttgggtctatgctatctactcctataatcaaccctccacaatctgccattcta
ggcatacatgcaactaaagagcgtgctatagttgagaacgggcaaattgttattcgtcca
atgaattatctagctttatcttatgaccatagaataatagatggtagagaagctgtttta
gggttggtagctattaaggatgctttagaagatcctcaacgtcttttattggatttgtag

DBGET integrated database retrieval system