KEGG   Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis): CKBE_00554Help
Entry
CKBE_00554        CDS       T02427                                 

Gene name
odhB
Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
kbl  Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis)
Pathway
kbl00020  Citrate cycle (TCA cycle)
kbl00310  Lysine degradation
kbl01100  Metabolic pathways
kbl01110  Biosynthesis of secondary metabolites
kbl01120  Microbial metabolism in diverse environments
kbl01130  Biosynthesis of antibiotics
kbl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kbl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CKBE_00554 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    CKBE_00554 (odhB)
Enzymes [BR:kbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CKBE_00554 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF86
Motif
Other DBs
NCBI-ProteinID: AFZ83743
Position
complement(615064..616263)
Genome map
AA seq 399 aa AA seqDB search
MAIQEVVVPQLSESVSEATMLSWKKSVGAFVESGEILIEIETDKVVLEVPAPSSGILVEI
VMGDNSTVVSGELIAKIDTDAKPSVTDSKPSKQIQSTVNSDKIQNKDLKGVASPSASKIL
SEKGIEPSTVNGTGRDGRITKSDALISDKKTSSKTEEFAPSSLSLDGRSEQRVPMSRLRA
RIAERLIQSQQENAILTTFNEVNMQSVIDIRKQYKDKFEKEHGVKLGFMSFFVKAAVSAL
KKYPLINASIDGKDIIYHGYFDIGIAVGSPRGLVVPILRDADQLSIADIEKSIVDFGKRA
ADGKLSIEEMIGGTFSISNGGVFGSMLSTPIINPPQSAILGIHATKERAIVENGQIVIRP
MNYLALSYDHRIIDGREAVLGLVAIKDALEDPQRLLLDL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggctattcaagaagtagttgtaccccagttgtctgagtctgtctcagaagctactatg
ttgtcctggaaaaagtcagttggtgcttttgttgaatctggtgagattttaattgaaatt
gaaacagataaagttgtcctagaagttccagctccttcctcaggtattttggtagagata
gtgatgggtgataatagtacagttgtttctggcgaattaattgcaaagatagacacagat
gcgaaaccatctgtcactgattcaaaaccaagtaagcaaattcaaagtactgttaattct
gataagattcagaataaagatttgaaaggggttgcttcaccatcagcctcaaaaattttg
tcagagaaaggtatagagccttctactgtaaatggcactggaagggatggtcgcataaca
aaatctgatgctttgatatctgataaaaaaacatcatcaaagacagaggaatttgcaccg
tcctcactgtcattagatggacgttctgagcaacgcgtgcctatgagtagattgcgcgct
cgtattgctgaacgtcttattcagtctcaacaagaaaatgctattctgactacattcaat
gaagtcaatatgcaatctgttatagatattaggaaacagtataaggataagtttgaaaag
gaacatggtgttaagcttggcttcatgtctttctttgttaaagctgccgtttctgcattg
aagaaatatcctttgataaatgcttccatagatggtaaagatataatatatcatgggtat
tttgatataggtatagctgtcggcagtcctagaggacttgtggttcctatacttcgtgat
gcagatcagctatctattgccgatatagaaaaatctattgttgattttgggaaacgagca
gcagatggtaaacttagcatagaagaaatgattggtggaactttttctatatcaaatggt
ggagtgtttgggtctatgctatctactcctataatcaaccctccacaatctgccattcta
ggcatacatgcaactaaagagcgtgctatagttgagaacgggcaaattgttattcgtcca
atgaattatctagctttatcttatgaccatagaataatagatggtagagaagctgtttta
gggttggtagctattaaggatgctttagaagatcctcaacgtcttttattggatttgtag

DBGET integrated database retrieval system