KEGG   Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis): CKBE_00653Help
Entry
CKBE_00653        CDS       T02427                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
kbl  Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:kbl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CKBE_00653 (ruvA)
Enzymes [BR:kbl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CKBE_00653 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
730894..731469
Genome map
AA seq 191 aa AA seqDB search
MIERITGKLIEKSTNSVCLDVNGICYEIEITSNTINSLPAINEQTTLFTHLLIREDAHIL
FGFNNPETRNTFRLLIKTAGIGARTALSVLSTLTVDELSNSILMQEPSILTKVPGIGQKT
AERLLLELKNKIKSETGLNSLQVPQRQSDIINALVSLGYSYKETIKIINLVPEDLALSES
IKYALKLLSSG
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaagaataacaggtaaattaatagaaaagagcacgaatagtgtttgtttagat
gtcaatggaatatgttatgaaatagaaataacatcaaatactattaattctcttccagct
attaatgaacaaacaaccttgttcacgcatctattaatacgtgaggatgcccacatatta
ttcggttttaataatcctgagactagaaataccttccgcctgctgattaaaacagcggga
ataggagctcgaacggctttatctgttctttcaacattaacagttgatgaattgtcgaat
tctatattaatgcaagaaccatccatattaactaaggttcctggaatagggcaaaaaact
gcagagcgtttactactagaactaaaaaataaaataaaatcagaaactggattaaattcg
ctacaagttcctcaaaggcagtctgatattattaatgcgctagtatcattaggttattca
tacaaagaaacaatcaagataattaatcttgttccagaggatctcgccttatcagagagt
ataaaatatgcgcttaaattactgagttctgggtaa

DBGET integrated database retrieval system