KEGG   Candidatus Kinetoplastibacterium blastocrithidii TCC012E: BCUE_0232Help
Entry
BCUE_0232         CDS       T02463                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
kbt  Candidatus Kinetoplastibacterium blastocrithidii TCC012E
Pathway
kbt00340  Histidine metabolism
kbt01100  Metabolic pathways
kbt01110  Biosynthesis of secondary metabolites
kbt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kbt00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BCUE_0232
Enzymes [BR:kbt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BCUE_0232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AGF49476
UniProt: M1LZI3
Position
complement(23745..25058)
Genome map
AA seq 437 aa AA seqDB search
MITRLDSIDPNFYSSLSSILEFDSNEDESIEKTVNLILKDIKNDGDKALLNYTRKFDRLN
VDSPDKLEIPKEEWIKSLNNVPKQQREALEISVNRIKEYHEKQRAFTWSYKDSYDNILGQ
KITPIDKVGLYVPGGKASYPSSVLMNAIPAKIAGVPELIMVSPTPDGYINSMVLAAAALG
DVDRIFAIGGAQAIGSLAYGTETVNQVDKIVGPGNAYVACAKRKVFGTVGIDMIAGPSEI
LIICDGKTPAEWIAMDLFSQAEHDELAQSIMLCPDMDFINEVEDQIKKLIHRMPRVDILK
KSLSNRGALIKVNNLSEACDIANIIAPEHLEISTENATELVPLIRHAGAIFIGCFSSESL
GDYCAGPNHVLPTSRTARFSSPLGVYDFQKRSSLINISEKGSIGLGKIASTLANSEGLQA
HASSAQYRIDGKYHDSK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgattacacgtcttgattctattgatccaaatttctactcatctctttcctctatatta
gaatttgactctaatgaagatgaatctattgaaaaaacagtaaatttaatattaaaagat
ataaagaatgatggagacaaagctttactaaattatactagaaaatttgaccgtcttaat
gtagattctccggataaattagaaattccaaaagaggaatggataaaatcacttaacaat
gttccaaagcaacaacgcgaagcgttggaaatttctgttaacagaatcaaagaatatcat
gagaaacaaagagcattcacttggagttataaagattcgtatgataatattcttggacaa
aaaataacacctatagacaaagtagggctatatgtaccaggaggtaaagcttcataccca
tcgtccgtccttatgaatgcaatacctgcaaaaatagctggtgttccagaattgattatg
gtttcacctactccagatggttatattaatagcatggttctagctgctgctgcattagga
gacgttgacagaatatttgctataggcggggcacaagccataggctccctagcatatggc
acagaaaccgtgaatcaagtagataaaatagtggggccaggtaatgcatatgtagcatgt
gcgaaacgcaaggtttttggaacggtaggaatagatatgatagcaggtcctagcgagata
ttgattatatgcgatggaaaaacacctgccgaatggatagctatggatttattttcacaa
gcagaacatgatgagctagcacaatctataatgttatgtccagatatggactttataaat
gaagtagaggatcaaattaaaaaattgattcatagaatgcctagagttgatattttaaaa
aaaagtttatcaaatcgaggagctttaattaaggtaaacaatctatctgaagcatgtgat
atagcaaatattattgccccagagcatttagaaatatctacagaaaatgctactgaatta
gtgcctttaataagacatgcaggagcaatatttataggatgctttagttccgaatcattg
ggagattattgtgctggacctaaccatgtattaccgacttcccgcacagcaagattctca
tctccattaggggtatatgatttccaaaaacgttcaagtcttattaatatttcagagaag
ggatcgataggcctagggaaaatagcgtcaactctggcaaacagtgaaggactgcaagcc
catgcatccagtgctcaatatcgtatagacggaaaatatcatgatagcaaataa

DBGET integrated database retrieval system