KEGG   Candidatus Kinetoplastibacterium blastocrithidii TCC012E: BCUE_0445Help
Entry
BCUE_0445         CDS       T02463                                 

Definition
uroporphyrinogen-III synthase hemD (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
kbt  Candidatus Kinetoplastibacterium blastocrithidii TCC012E
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:kbt00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
240140..240934
Genome map
AA seq 264 aa AA seqDB search
MLAQKVFILTRPNSNKILSDSLNDAGFETLSLPSLKIKPFDLKDVPFPGIYDFIFFSSGN
AVRCYLILLNKIYGTIEWPSSTIVVTVGVATANSFRSSDLINIGSLTVLSPNSSALQIDS
ESLWDVLKRQCLHGKRFLFVRGSTGRDWLINKVSEYCEVDLCSVYFRDNVEWSCYDSGRL
KVISERSAITVWLFTSIESIEATIRNIVLLNLEDWFSSCRFIVTHQRIYNFLSSYFIKCI
GFNKVVIKECLPYDESIIMACKSI
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgttagctcaaaaagtttttattctaacaagaccgaatagtaataaaatactatccgat
agtcttaacgatgctggttttgaaactttatctcttccttctttaaaaattaaacctttt
gatctaaaggatgtaccctttccagggatttatgattttatttttttttcaagtggcaat
gctgttagatgttatctaattctgttaaataagatttatggaaccatagaatggccttca
agcacgatagttgttacggtgggggttgcaactgctaatagttttcgttcctctgattta
attaatattggctcattgacagtattgagtccaaattcttctgctttgcagattgattct
gaatcattgtgggatgttttaaaaagacagtgtttgcatggcaaaagatttctttttgtt
agaggatcaacaggtagagattggcttattaacaaagtttctgagtattgtgaggtggat
ttgtgttctgtgtattttagagataatgtagaatggtcttgttatgattcagggagatta
aaagtcatatcagaaagatctgctataactgtatggcttttcactagtatagagagtatt
gaggcaactatcagaaatatagttcttttgaatcttgaagattggtttagtagttgtaga
tttatagttacacatcagagaatttacaattttctatctagttattttatcaaatgtatt
ggttttaacaaagttgtgataaaagagtgtttgccttatgacgagtctattattatggca
tgtaagagtatttaa

DBGET integrated database retrieval system