KEGG   Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255): CKCE_0071Help
Entry
CKCE_0071         CDS       T02413                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
kci  Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:kci00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CKCE_0071 (ruvA)
Enzymes [BR:kci01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CKCE_0071 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(90778..91353)
Genome map
AA seq 191 aa AA seqDB search
MIERISGLLLETWSNSICVDVHGVGYEIEIPTSLLTKLPKIGEKVTLFTYLVIREDAHIL
FGFDNQQDRVIFKSLMKTNGIGIRTALSILSNMTVKEIISAITLQDTSILTKIPGIGQKT
AERLILEMRDKIKSSHIEDNFCESGKKTDIIEAMTSLGYSSKEIMSIINLLPDQLTLPET
IKYALRLLNKS
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaagaatctctggcttattgttagaaacatggtcgaacagcatttgtgtagat
gtgcatggagtcggttatgaaatagaaataccaacaagtctattaacaaaattacccaag
attggagaaaaagttacattatttacttatttggtaataagagaagatgcacatatatta
tttggatttgataaccaacaagatagagttatatttaaatcccttatgaaaacaaatggc
attggaataagaacagctttgtcaatcttatctaacatgactgttaaagaaataatatca
gcaattacattacaagacacgtcaatcttaactaaaataccaggaataggacagaaaaca
gcagaaagactaatattagaaatgagagataaaataaaatcctcacatattgaagataat
ttttgtgaatcaggtaagaaaacagacataatagaagcaatgacttctttggggtattca
tcaaaagagattatgtctataattaatttattaccagatcaactgactctgccagaaact
ataaaatatgctcttagactattaaacaaaagctaa

DBGET integrated database retrieval system