KEGG   Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255): CKCE_0076Help
Entry
CKCE_0076         CDS       T02413                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
kci  Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255)
Pathway
Pentose and glucuronate interconversions
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kci00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CKCE_0076 (galU)
   00052 Galactose metabolism
    CKCE_0076 (galU)
   00500 Starch and sucrose metabolism
    CKCE_0076 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CKCE_0076 (galU)
Enzymes [BR:kci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CKCE_0076 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(95350..96213)
Genome map
AA seq 287 aa AA seqDB search
MSKIRKAIFPLGGGMGTRLLPITKALPKEIIPIIDKPLIQYAVEEAISAGITELIFITSR
NKRIIEDHFDSSPELEKYLIDNNKTEMLSIIENIVPRNIKFSFIRQSKPLGLGHAILSAE
HIINNEEFAVILADDLIDSKIPAIKQLMLIFQQTNSNVIAIQDVSLEDVENYGIAATQKY
PKIKNTEEISSIVEKPTRKSSPSQTAIVGRYILKPDIFDHLRIITPDIKGEIQLTAAIIS
LLKEQKILAYRYEGQRFDCGTKHGIFYANIYFGKKYHGFNAINKFIE
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagattagaaaggctatatttccattaggaggtggaatggggacaagactttta
ccaataacaaaagcactccccaaagaaataattccaataatagataaacctttaattcaa
tatgctgtagaagaagccatatctgctggaataactgaattaatttttattaccagccgc
aacaaaagaatcatagaagatcatttcgactcatctccagaattagaaaaatatctaatt
gataataataaaaccgaaatgctcagcataatagaaaacattgtaccaagaaatataaaa
tttagctttatcagacaatcaaaaccactaggtcttggtcatgcaatactgagcgctgag
catattataaataatgaagaattcgctgtaatactagcggatgatctaatagactctaaa
atacctgccattaaacaattaatgctgatatttcaacaaacaaattctaatgttattgct
attcaagatgtttcattagaagacgtagaaaattatggcatagcagccacgcaaaaatat
cctaaaataaaaaatactgaagaaattagtagtattgtagaaaaacctactcgaaaaagc
tctccatctcaaacggctatcgttggcagatatatacttaaacctgatattttcgatcat
ctacgtattatcacaccagatataaaaggcgaaattcaattaactgcagctataatctct
cttttaaaagaacaaaagatcttggcttatagatatgaagggcaaagatttgattgtgga
acaaaacatggaatattctatgccaacatatattttggaaaaaaatatcatggattcaat
gcaataaataagtttatagaataa

DBGET integrated database retrieval system