KEGG   Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255): CKCE_0164Help
Entry
CKCE_0164         CDS       T02413                                 

Definition
hypothetical protein
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
kci  Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:kci00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CKCE_0164
   00240 Pyrimidine metabolism
    CKCE_0164
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CKCE_0164
   03430 Mismatch repair
    CKCE_0164
   03440 Homologous recombination
    CKCE_0164
Enzymes [BR:kci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CKCE_0164
DNA replication proteins [BR:kci03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CKCE_0164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(185607..186053)
Genome map
AA seq 148 aa AA seqDB search
MQIDFVFDIKNKLLSTCHIIKEIYMTSSVIVFCEDKETAHKIDKLLWSFDDISFIPHSIS
NDCNKNNTRVTITTKDLFELKYIDKTNKNYLSYIVNLSNNYPQHYNQFDHLIEIVSEDEN
DRAKARLKWKFYKQNGHIVKGKPFKIST
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattgattttgtatttgatattaaaaataaattattatctacttgtcatataatt
aaagaaatttatatgacaagtagtgttatagtattttgtgaagacaaagaaactgcacat
aaaatagataagttactatggtcttttgatgatatatcttttataccacattcaataagt
aatgattgtaataaaaataatacgagagtaaccattactactaaagatttatttgaatta
aaatatattgacaaaactaacaaaaattatttatcatatatagtgaatttatctaacaat
tatccacaacactataatcaatttgatcatcttatagaaatagtatcagaagatgaaaat
gatcgtgcaaaagcacgacttaagtggaaattctataaacagaatggccatattgtaaag
ggaaaaccttttaagatttctacttaa

DBGET integrated database retrieval system