KEGG   Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255): CKCE_0164Help
Entry
CKCE_0164         CDS       T02413                                 

Definition
hypothetical protein
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
kci  Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:kci00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:kci00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:kci03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:kci03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:kci03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(185607..186053)
Genome map
AA seq 148 aa AA seqDB search
MQIDFVFDIKNKLLSTCHIIKEIYMTSSVIVFCEDKETAHKIDKLLWSFDDISFIPHSIS
NDCNKNNTRVTITTKDLFELKYIDKTNKNYLSYIVNLSNNYPQHYNQFDHLIEIVSEDEN
DRAKARLKWKFYKQNGHIVKGKPFKIST
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattgattttgtatttgatattaaaaataaattattatctacttgtcatataatt
aaagaaatttatatgacaagtagtgttatagtattttgtgaagacaaagaaactgcacat
aaaatagataagttactatggtcttttgatgatatatcttttataccacattcaataagt
aatgattgtaataaaaataatacgagagtaaccattactactaaagatttatttgaatta
aaatatattgacaaaactaacaaaaattatttatcatatatagtgaatttatctaacaat
tatccacaacactataatcaatttgatcatcttatagaaatagtatcagaagatgaaaat
gatcgtgcaaaagcacgacttaagtggaaattctataaacagaatggccatattgtaaag
ggaaaaccttttaagatttctacttaa

DBGET integrated database retrieval system