KEGG   Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255): CKCE_0164Help
Entry
CKCE_0164         CDS       T02413                                 

Definition
(GenBank) hypothetical protein
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
kci  Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255)
Pathway
kci00230  Purine metabolism
kci00240  Pyrimidine metabolism
kci01100  Metabolic pathways
kci03030  DNA replication
kci03430  Mismatch repair
kci03440  Homologous recombination
Module
kci_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:kci00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CKCE_0164
   00240 Pyrimidine metabolism
    CKCE_0164
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CKCE_0164
   03430 Mismatch repair
    CKCE_0164
   03440 Homologous recombination
    CKCE_0164
Enzymes [BR:kci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CKCE_0164
DNA replication proteins [BR:kci03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CKCE_0164
DNA repair and recombination proteins [BR:kci03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     CKCE_0164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi DALR_1
Motif
Other DBs
NCBI-ProteinID: AFZ82603
Position
complement(185607..186053)
Genome map
AA seq 148 aa AA seqDB search
MQIDFVFDIKNKLLSTCHIIKEIYMTSSVIVFCEDKETAHKIDKLLWSFDDISFIPHSIS
NDCNKNNTRVTITTKDLFELKYIDKTNKNYLSYIVNLSNNYPQHYNQFDHLIEIVSEDEN
DRAKARLKWKFYKQNGHIVKGKPFKIST
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattgattttgtatttgatattaaaaataaattattatctacttgtcatataatt
aaagaaatttatatgacaagtagtgttatagtattttgtgaagacaaagaaactgcacat
aaaatagataagttactatggtcttttgatgatatatcttttataccacattcaataagt
aatgattgtaataaaaataatacgagagtaaccattactactaaagatttatttgaatta
aaatatattgacaaaactaacaaaaattatttatcatatatagtgaatttatctaacaat
tatccacaacactataatcaatttgatcatcttatagaaatagtatcagaagatgaaaat
gatcgtgcaaaagcacgacttaagtggaaattctataaacagaatggccatattgtaaag
ggaaaaccttttaagatttctacttaa

DBGET integrated database retrieval system