KEGG   Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255): CKCE_0178Help
Entry
CKCE_0178         CDS       T02413                                 

Gene name
odhB
Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
kci  Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CKCE_0178 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CKCE_0178 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    CKCE_0178 (odhB)
Enzymes [BR:kci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CKCE_0178 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
204628..205842
Genome map
AA seq 404 aa AA seqDB search
MAIIDVVVPQLSESISEATMMSWKKSVGSFVESDEILIEIETDKVVLEVPAPSSGVLIEI
VRGDSSTVISGELIAKIDTAAKATSVDVSKNVSNPSETSNQTSNHNVKDMKNVASPAASK
ILSEKGLDVSSISGSGRDGRVTKSDVLSAKSSSDAVKHAVDNTQPKTFSIDGRPEQRVPM
SRLRSRIAERLIQSQQENAILTTFNEVNMQSVIDIRRKYKDKFEKEHGVKLGFMSFFVKA
AVAALKKFPLINASIDGKDIIYHGYFDIGIAVGSPRGLVVPILRNADQLSISDIEKSIAD
FGKRAADGKLSIEEMTGGTFSISNGGVFGSMLSTPIINPPQSAILGIHATKERAVVENGQ
VVIRPMNYLALSYDHRIIDGREAVLGLVAIKDALEDPQSLLLDL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggctattattgatgttgttgttcctcagttatctgagtctatttcagaagctactatg
atgtcttggaaaaagagcgtaggttcttttgtagagtcagatgagattttaattgaaatt
gaaactgataaggttgttttagaagttccagccccatcttctggcgtgctaatagaaata
gttagaggtgacagtagtactgttatttctggtgagttaattgcaaaaatagatactgct
gccaaagcaacttctgtagatgtttctaaaaatgtttcgaatcctagtgaaacgtcaaat
caaacttccaatcataatgttaaggatatgaaaaatgtcgcttcacctgcagcttcaaaa
atcttatctgagaaaggattagatgtatcatcaatatctggttcaggaagggatggtaga
gtaacaaaatctgatgttttgtctgcaaagtcttcatctgatgctgttaaacatgcagta
gataatacacagccaaaaacattttctattgatggaaggccagaacagcgtgttcctatg
agtcgtttgagatcaaggattgctgaaagattaatacaatctcaacaagaaaatgcgata
ttaactacttttaatgaagttaatatgcagtctgttattgacataagacgtaaatataaa
gataagtttgaaaaagaacatggtgtgaagcttggttttatgtctttctttgtgaaggct
gctgttgctgcacttaagaaatttccattaattaatgcttctattgatggcaaagatatt
atatatcatggttattttgatattggtattgctgttggtagtccaagaggacttgttgtc
ccaatacttagaaatgcagatcagttatctatatcagacatagagaaatctattgctgat
tttggtaaaagagcagcagatggtaaattaagtatagaagaaatgacaggtggaacattt
tccatatcaaatggcggagtctttgggtcaatgttgtctactccaataattaaccctcca
caatctgctattcttggaatccatgctactaaagaacgtgctgttgttgaaaatggtcaa
gtagttattcgtcctatgaattatctagcattatcttacgatcataggattattgatggt
cgtgaagctgtattgggtttagtagcaattaaagatgcattagaagatccacaaagtctt
ttattggatttgtaa

DBGET integrated database retrieval system