KEGG   Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255): CKCE_0275Help
Entry
CKCE_0275         CDS       T02413                                 

Definition
(RefSeq) alcohol dehydrogenase, propanol-preferring
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
kci  Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255)
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kci00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CKCE_0275
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKCE_0275
  Lipid metabolism
   00071 Fatty acid degradation
    CKCE_0275
  Amino acid metabolism
   00350 Tyrosine metabolism
    CKCE_0275
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CKCE_0275
   00626 Naphthalene degradation
    CKCE_0275
Enzymes [BR:kci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CKCE_0275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(303854..304882)
Genome map
AA seq 342 aa AA seqDB search
MQEKDIDLPVPHTNQVLLKVKASGICHSDIHLCNGYYDIGMGKKFELKDRGIELPLVLGH
EIVGNVVAKGEDVKDIEIGGNYIVYPWIGCGICENCKESCENYCLSPQYLGINKPGGFAE
YILVPHYKYLVNIKNMDPAMIAQYACAGLTTYSAINKIEKNIYKKKPVVIFGAGGLGLMA
VSILKALGGYGSIVITNDLNKKQAALEAGALAVFDYNDEHLVKKLLDHNSNHKYHAVIDL
VGNSNTTKASFDILEKSGALIIVGMFGGLSNWPLAFIPMKALKIIGSYVGNLSEFNELMK
LVIDQKLEPVQIKKYDFDKLNEALSDLRSGKVVGRAVIINNI
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggaaaaagatatagacttacctgttcctcatacaaaccaggttttgttgaaagta
aaggcatctggaatatgtcatagtgatatccatttatgtaacggatattatgatattggt
atgggtaaaaaatttgaattaaaagatagagggattgaattacctctagttcttggtcat
gaaatagttggaaatgttgttgctaagggagaagatgttaaagatatagaaataggtggt
aattatatagtatatccgtggataggttgtggaatctgtgaaaattgtaaagaatcatgt
gaaaattactgcttaagtcctcaatatcttggcataaataaaccaggagggtttgcagaa
tatatcttagttcctcattataaatatctcgtaaatattaaaaatatggatcctgctatg
atagctcagtatgcttgtgctggattaactacatattcagcaattaataagattgagaaa
aatatctataagaaaaagccagttgtaatttttggtgctggtggtttgggattaatggct
gtttctattttgaaagctcttggtggttatggcagtattgttataactaatgatttaaat
aaaaaacaggccgctttagaagcaggcgctttagctgtttttgattataatgacgaacat
ttagtaaagaaattactagatcataattctaatcataagtatcatgctgtcattgatcta
gttggaaactctaacactacaaaagcatcttttgatatcttagaaaaatcaggagcatta
attatagttggtatgtttggtggtttatcaaactggccattagcattcattcctatgaaa
gctttaaaaatcataggaagttatgttggtaatttatctgaatttaatgaattaatgaaa
ttggtaattgatcaaaaattagaaccagtacaaattaagaaatatgattttgataagctt
aatgaagcgctgtcagatttaagatctggtaaggttgttggtagagccgtcattattaat
aatatttag

DBGET integrated database retrieval system