KEGG   Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255): CKCE_0275Help
Entry
CKCE_0275         CDS       T02413                                 

Definition
alcohol dehydrogenase, propanol-preferring
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
kci  Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255)
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kci00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CKCE_0275
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKCE_0275
  Lipid metabolism
   00071 Fatty acid degradation
    CKCE_0275
  Amino acid metabolism
   00350 Tyrosine metabolism
    CKCE_0275
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CKCE_0275
   00626 Naphthalene degradation
    CKCE_0275
Enzymes [BR:kci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CKCE_0275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(303854..304882)
Genome map
AA seq 342 aa AA seqDB search
MQEKDIDLPVPHTNQVLLKVKASGICHSDIHLCNGYYDIGMGKKFELKDRGIELPLVLGH
EIVGNVVAKGEDVKDIEIGGNYIVYPWIGCGICENCKESCENYCLSPQYLGINKPGGFAE
YILVPHYKYLVNIKNMDPAMIAQYACAGLTTYSAINKIEKNIYKKKPVVIFGAGGLGLMA
VSILKALGGYGSIVITNDLNKKQAALEAGALAVFDYNDEHLVKKLLDHNSNHKYHAVIDL
VGNSNTTKASFDILEKSGALIIVGMFGGLSNWPLAFIPMKALKIIGSYVGNLSEFNELMK
LVIDQKLEPVQIKKYDFDKLNEALSDLRSGKVVGRAVIINNI
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggaaaaagatatagacttacctgttcctcatacaaaccaggttttgttgaaagta
aaggcatctggaatatgtcatagtgatatccatttatgtaacggatattatgatattggt
atgggtaaaaaatttgaattaaaagatagagggattgaattacctctagttcttggtcat
gaaatagttggaaatgttgttgctaagggagaagatgttaaagatatagaaataggtggt
aattatatagtatatccgtggataggttgtggaatctgtgaaaattgtaaagaatcatgt
gaaaattactgcttaagtcctcaatatcttggcataaataaaccaggagggtttgcagaa
tatatcttagttcctcattataaatatctcgtaaatattaaaaatatggatcctgctatg
atagctcagtatgcttgtgctggattaactacatattcagcaattaataagattgagaaa
aatatctataagaaaaagccagttgtaatttttggtgctggtggtttgggattaatggct
gtttctattttgaaagctcttggtggttatggcagtattgttataactaatgatttaaat
aaaaaacaggccgctttagaagcaggcgctttagctgtttttgattataatgacgaacat
ttagtaaagaaattactagatcataattctaatcataagtatcatgctgtcattgatcta
gttggaaactctaacactacaaaagcatcttttgatatcttagaaaaatcaggagcatta
attatagttggtatgtttggtggtttatcaaactggccattagcattcattcctatgaaa
gctttaaaaatcataggaagttatgttggtaatttatctgaatttaatgaattaatgaaa
ttggtaattgatcaaaaattagaaccagtacaaattaagaaatatgattttgataagctt
aatgaagcgctgtcagatttaagatctggtaaggttgttggtagagccgtcattattaat
aatatttag

DBGET integrated database retrieval system