KEGG   Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255): CKCE_0301Help
Entry
CKCE_0301         CDS       T02413                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
kci  Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255)
Pathway
kci00900  Terpenoid backbone biosynthesis
kci01100  Metabolic pathways
kci01110  Biosynthesis of secondary metabolites
kci01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:kci00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CKCE_0301
Enzymes [BR:kci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CKCE_0301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AFZ82735
Position
complement(329875..331086)
Genome map
AA seq 403 aa AA seqDB search
MREVRRVFIFGSTGSIGEKSLEVISINKDRFEVFGLSANSQIERLAKQAINFNVKVVVVP
NKQARERFYKAMPICYNVPEVLIGENSLMNVASSGLYDIAIIATSGVAGLYSALEAAKSG
KRILLANKELLVIAGQLFMDAVSLNKTEIIPIDSENNSIFQCLHRNSYLDNTKNEFANNY
INKIILTDSGGPFRSMSVDQLEDVTPLHIYKYHNWQIGQKISVDSATMINKGFEIIETFW
LFSMPIESIDILIQPQSIVHSMIEYSDGSVIANLSKPNMEIPISYALSFPDILENNVGFL
DLSKVCSLDFFKPDLERFQCLNLSFEALNAGPGYCIVLNAANEVAVEGFLSGRLKYTWIP
RVIEASFEWYSSKLSKKLLSLDEIINLDLEARYFASNLGIGLS
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttgagagaggtaaggcgtgtttttatatttggttctactggctcaattggagaaaaatct
ttagaagttattagcataaacaaagatcgcttcgaagtatttggtctgagcgcgaacagt
caaatagaacgtttagcaaaacaggcgataaattttaatgtaaaagtagtagtagttcct
aataagcaggcaagagagcgtttttataaagctatgcctatttgttacaatgttcctgaa
gtcttaataggtgaaaattcattaatgaatgtagcttcttcaggattatatgatatagca
attattgctacatctggagtagctggattatattctgcattagaagcagctaaaagtgga
aagcgtattttattggctaataaagaattattagttattgctggtcagttatttatggat
gctgtttctttaaataaaactgaaataattcctatagatagtgaaaataattctatcttc
cagtgtcttcatagaaacagttacctggataacacaaaaaatgaatttgcaaataattat
ataaataaaattattcttacagattctggaggtccttttagaagtatgtctgtagatcag
ttagaagatgttacaccacttcatatttataaatatcataattggcaaattggtcagaaa
atatctgttgattcagcaacaatgataaataaaggctttgagattatagagactttttgg
ttgttttctatgccaatagaatctatagatatattaatacagcctcaaagtatagttcat
tcaatgatagaatattcagatggttcagttatagctaatttaagtaaacctaatatggaa
atacctatatcatatgcattaagttttccagatattttagaaaataatgttggtttttta
gatttatctaaagtatgttcgttagatttttttaagcctgatttagaaagatttcaatgt
ctaaatttatcctttgaagctttaaatgctggtccaggttattgtatagtattaaacgca
gctaatgaagttgcggtggaaggatttttatcaggtcgtttaaaatacacatggattcct
agagtaattgaagcttcttttgaatggtattcaagtaaattatccaaaaaattattaagt
ttagatgaaataattaatcttgatcttgaagctcgatattttgcttctaatcttgggata
gggttatcctaa

DBGET integrated database retrieval system