KEGG   Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255): CKCE_0326Help
Entry
CKCE_0326         CDS       T02413                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
kci  Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255)
Pathway
kci00010  Glycolysis / Gluconeogenesis
kci00020  Citrate cycle (TCA cycle)
kci00620  Pyruvate metabolism
kci01100  Metabolic pathways
kci01110  Biosynthesis of secondary metabolites
kci01120  Microbial metabolism in diverse environments
kci01130  Biosynthesis of antibiotics
kci01200  Carbon metabolism
Module
kci_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKCE_0326 (aceF)
   00020 Citrate cycle (TCA cycle)
    CKCE_0326 (aceF)
   00620 Pyruvate metabolism
    CKCE_0326 (aceF)
Enzymes [BR:kci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CKCE_0326 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H CAT HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AFZ82760
Position
complement(358717..360015)
Genome map
AA seq 432 aa AA seqDB search
MNEIIEFNMPSVGDSKEFRVIEVLVSIGDEVISEQGVITIESDKASMEVPAPCAGIVKSV
NVKVGDKISENFHLLSIEKNNTDIVSAVPEKSNIDNISIKDVPVNSKIKSEKILVSDNNI
DHISSINNRDVVKNFSYASPSIRKFARELGVEISQVHGTGKKGRITVDDVSSFVKNNLNN
PSVTSGAELFNLPPWPKIDFAQFGEIDSKPLSRIQKISGSSLHRNWMMIPHVTNNDEADI
TDLEDFRAKINQDLSKSNIKVTMLSFLVKALVSCLKKFPDFNASLDNDKLILKKYYNIGF
AVDTPNGLMVPVIHNVDNKGVIEIASEIKNLSQKAREGKLFAKEMQGGCFSISSLGGIGG
VSFTPIVNAPEVAILGVSKSAFKPLWDGKQFVPRLIMPISLSYDHRVIDGAMAAHFNKYL
CQIMNDFRLISL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaattatagaatttaatatgccatcagttggagattcaaaggaatttcgagtt
atagaagttttagtttctataggagatgaagttatttcagaacaaggtgttattactata
gaatcagataaagcttctatggaagttcctgctccttgtgcaggtatagttaaatcggtt
aatgtaaaggttggtgataaaatctctgagaattttcatttgctatctatagaaaaaaat
aataccgatattgttagtgcagttccagagaaatcaaatatagataatatttctataaaa
gatgtacctgttaatagcaagattaagagcgaaaaaatattagttagtgataataatatt
gatcatatttcatctatcaataatagggatgtagtaaaaaatttttcttatgcctctccg
tctataaggaagtttgctagagaattgggtgtagaaatttctcaagtacatggaacaggt
aagaagggtcgtattactgtggatgatgttagttcttttgttaaaaataatttaaataat
ccatctgtaactagtggcgctgaattatttaatttgccaccttggccaaaaatagatttt
gctcaatttggtgaaattgatagcaagccattgagtaggattcagaaaatatctggttcc
agtttgcatcgtaactggatgatgatacctcatgttactaataatgatgaggctgatatt
actgatttagaagattttagagctaaaataaatcaagatttatctaaaagcaatataaaa
gttactatgttatcttttttagttaaagcactagtttcttgtttaaaaaaatttccagat
tttaatgcttctttggataatgataaactaatacttaaaaaatattataatataggattt
gctgtagatactcctaatggattaatggttcctgtaatacataatgttgataataaaggc
gttattgaaattgcatcggaaataaaaaacttatctcaaaaagctagggaaggcaaatta
tttgctaaagagatgcagggtggatgtttttctatttcttctctaggaggaataggtggt
gtttcttttactccaatagttaacgctccagaagtagcgatattaggtgtatctaaatct
gcctttaaaccgttgtgggatggtaaacaattcgtgccaagattgattatgcctatatct
ctttcttatgatcatagagttatcgatggtgcaatggccgcacattttaataaatatttg
tgtcaaattatgaatgattttcgtcttatttctttataa

DBGET integrated database retrieval system