KEGG   Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255): CKCE_0389Help
Entry
CKCE_0389         CDS       T02413                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
kci  Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:kci01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:kci00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
418680..419819
Genome map
AA seq 379 aa AA seqDB search
MSEKSLTLQIAKKLIGCKSVTPEDAGCQNLLIEELKKFDFQIQTIVKNGVTNLFAIRERK
GPLLAFAGHSDVVPAGNLDQWTTDPFIPIESNGFLYGRGSSDMKGSIAAFLVATMEFLEE
NPNHDGSIAFIITSDEEGPANYGTKIVCDYLKNKNIEIDYCIVGEPTSEKELGDMFKNGR
RGSLSGNLTINGIQGHVAYPHLANNPIHLAPEALLEIINIKWDNGNEYFPPTTFQISNIH
SGNGATNVIPGELEIKFNLRFSTENTPESLKSKIHSILEKHNLNYNIEWILNGDPFLTKT
GTLTDTLSKSIKEELGIESKMSTSGGTSDGRFLTKVSKQIVEFGPCNETIHKVNECVKIT
DLAKLKNIYKKVIEKLLTK
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaagagcctaaccttacaaatcgcaaaaaaacttattggatgcaaatcagta
actccagaagatgctggatgtcaaaatttattaatagaagagttaaaaaaatttgatttt
caaattcaaactattgttaaaaacggagtgactaatctctttgcaatcagagaaagaaaa
ggcccattgttagcttttgctgggcattcagatgtggtcccagctggaaacctggatcaa
tggacaacagatcctttcatcccaatagaaagtaatggttttttgtatggtagaggctct
tctgacatgaaaggttctatagctgcattcttagttgcaactatggaatttctagaagaa
aatcctaatcatgatggttctatagcttttataataacctcagatgaagaaggacctgca
aattacggaactaaaattgtatgtgactatcttaaaaacaaaaacatagaaatagattat
tgcatcgtaggagaaccaacctcggaaaaagaactaggtgatatgtttaaaaatggacgt
cgcggatctttatcagggaatctaacaataaacggaatacaaggccatgttgcttatcct
catcttgctaataatcctatacatctagcgccagaggcactcttagaaattattaatatt
aaatgggacaatgggaatgaatacttccctcctacaacctttcaaatttccaatattcat
tctggaaatggagctacgaatgtaattccaggagaattagagataaagtttaatctacgt
ttttctactgaaaatacccctgaatctttaaaatcaaaaattcattcaatattagaaaaa
cataacttgaattacaatatagaatggattttaaacggagacccttttttaacgaaaaca
ggaactttgacagatacattatctaaatccattaaagaagaacttggaatagaaagcaaa
atgtctacttctggaggcacatcagatggtcgttttcttaccaaagtaagcaaacaaata
gtagagtttggcccttgcaatgaaacaatacacaaagtaaatgaatgtgtaaaaataaca
gatttagcaaaattaaaaaatatctacaaaaaagttatagaaaaactattaactaaataa

DBGET integrated database retrieval system