KEGG   Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255): CKCE_0419Help
Entry
CKCE_0419         CDS       T02413                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
kci  Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255)
Pathway
kci00020  Citrate cycle (TCA cycle)
kci00640  Propanoate metabolism
kci00660  C5-Branched dibasic acid metabolism
kci01100  Metabolic pathways
kci01110  Biosynthesis of secondary metabolites
kci01120  Microbial metabolism in diverse environments
kci01130  Biosynthesis of antibiotics
kci01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kci00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CKCE_0419 (sucC)
   00640 Propanoate metabolism
    CKCE_0419 (sucC)
   00660 C5-Branched dibasic acid metabolism
    CKCE_0419 (sucC)
Enzymes [BR:kci01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CKCE_0419 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Cation_ATPase_N
Motif
Other DBs
NCBI-ProteinID: AFZ82849
Position
complement(450457..451617)
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQGKELLRRFNVTVPRGIPAFSIDEAISAAEKLGGPVWVVKAQIHAGGRGKGGGV
KLARSLDEVKKISSEILGMQLVTHQTGSQGQKVRRLLIEEGADIRKEYYFGIVTDRGTQR
ICVMASSEGGMDIEEVAAKSPEKIIKVFVDPTVGLTNEEAKNLARSIGVPEQSVEKASLE
FIKLYKAYWDTDASLVEVNPLILTGDGNIVSLDAKFNFDANALFRHPDIVVYRDLDEEDP
AEVEASKFDLAYIQLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATASKVTE
AFKIMLKNKEVKAILVNIFGGIMRCDVIAEGVILACKAVDLKVPLVVRMKGTNEELGKKM
LSESGLPIISADTMAEAATKVVAAVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtatcaaggtaaagaactgcttagacggtttaatgtaactgtacca
cgtggcattccagcgttttctattgatgaagctatatctgctgctgaaaagcttggtggt
ccagtatgggttgttaaggctcaaattcatgcaggaggtcgaggtaaaggaggtggagtt
aaattagcacgttctttagacgaagtaaaaaaaatatcctcagaaatattgggtatgcaa
cttgtaactcaccagacaggttctcaaggacaaaaagttcgtcgtttattaattgaggaa
ggtgctgacataagaaaagagtactattttggcatagtaactgatcgaggaacacaaaga
atttgtgtcatggcttccagtgaaggaggtatggacatagaagaagtagcggcaaaaagt
cctgagaaaataataaaggtatttgttgaccctacagttggtttaactaatgaagaagct
aaaaatttagcaagaagtataggtgttccagagcaatcagttgaaaaagcatctttagaa
tttatcaaactgtataaagcttattgggatactgacgcatcattggttgaagttaacccg
ttgattttgacaggtgacggaaatatagtctcattggatgctaagtttaattttgatgct
aatgcgctttttcgtcatcctgatattgttgtctatcgtgatttagatgaagaagatcca
gcagaagtagaagctagtaagtttgatcttgcttatatacagctagatggaaatataggt
tgtttagtaaatggggcaggtttggcgatggctaccatggatactattaaactgtttggt
ggagaacctgctaactttcttgatgttggtggtggtgctacagcttctaaagtaacagaa
gcatttaaaataatgctaaaaaataaagaagtgaaagctattttagttaatatctttggc
ggaattatgagatgtgatgttattgctgaaggtgtaatattagcttgtaaagcagtagac
cttaaagttccattagttgtcagaatgaaaggaactaatgaagagttaggcaagaaaatg
ttgtctgaatctggtttgccaattatcagtgcagatactatggctgaggctgctaccaaa
gtcgttgctgctgttaaataa

DBGET integrated database retrieval system