KEGG   Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255): CKCE_0422Help
Entry
CKCE_0422         CDS       T02413                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
kci  Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:kci00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:kci00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(453592..454890)
Genome map
AA seq 432 aa AA seqDB search
MLMRLFVMSNMSQQMLLQEMMDKFGFKKENLAAYLGVNGKILNSWFASSLSTEYTPMPNG
VFNYISEFIEKNSLSGVYNLPLRNKISFFGKNHLLSVEQFDRDSIEEVFSIADLMVPIAR
RKKISRVLEGAVLGNLFFEASTRTRVSFGTAFCRLGGSVCDTTGFTFSSMAKGESIYDTS
RVIAGYVDIMVVRHPDRGSVSEFARASNIPIINGGDGPGEHPSQALLDLYTIKNEFSRLN
KSLDGAHISLIGDLKYGRTVHSLIKLLSLYKNLKISLVSPIGLEMPESIINYASRNGNIV
SVESSVKKGLSGADVVYATRVQKERFESEFEFRYESDFHINSEKINAFCNKDTIIMHPLP
RDSNVGSNDLSTDLNNDDRLAIFRQSDNGIPVRMAIFAILLGVENIVHRNLRDVEWSRPV
YISFADAAFHNL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgttaatgaggttatttgtaatgtctaatatgtctcagcaaatgcttttacaagaaatg
atggataaatttggttttaagaaagagaatcttgctgcctatttgggagtaaatggcaag
attttaaattcttggtttgcttctagtctaagtacagaatatacacctatgcctaatggt
gtttttaattatatatctgagtttattgaaaaaaattctttatctggtgtatacaatctt
cctttgcgaaataaaatttctttctttggtaaaaatcatcttttgtcagtagagcaattt
gatcgtgattcaatagaagaagtattctccattgctgatttaatggtaccaatagctcgt
cgtaaaaaaatttccagagttttggaaggagccgttttaggaaatcttttttttgaagcc
agtactcgtactagagttagttttggaacagctttttgtaggctaggtggttccgtatgt
gatacaactggttttactttttcttctatggctaaaggcgagtctatctatgatactagt
agggtaattgctggttatgttgatataatggttgttcgtcaccctgatcgtggttctgtt
tcagagtttgctagagcatctaatattcctattataaacggcggtgatggtcctggtgag
catcctagtcaagctttacttgatttatatacaataaagaacgaatttagcagattaaat
aaatcattggatggtgctcatatatctttgattggtgacttaaagtatggtagaactgtg
cattctttgatcaaactactatctttgtataaaaatttaaaaatttcattagtttctcct
attggcttagaaatgcctgagagcattataaattatgcttctagaaatggtaatattgtg
agtgttgagtcttctgtaaaaaaaggattgagtggcgcagatgttgtatatgctactaga
gttcaaaaagaaagatttgaatctgaatttgaatttcgatatgaaagtgattttcatatt
aacagtgagaagataaatgctttttgtaataaagatactatcataatgcacccattacca
agagatagtaatgtaggatcaaatgatcttagtacagacttgaataatgacgatcgtttg
gcaatttttaggcaatctgataatggcataccggttaggatggctatttttgctattctt
cttggtgtggaaaatatcgtacataggaatttaagggatgtagagtggagtcgtcctgta
tatattagttttgctgatgcagcatttcataatttataa

DBGET integrated database retrieval system