KEGG   Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255): CKCE_0635Help
Entry
CKCE_0635         CDS       T02413                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
kci  Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kci00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CKCE_0635 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CKCE_0635 (murA)
Enzymes [BR:kci01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     CKCE_0635 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(659264..660532)
Genome map
AA seq 422 aa AA seqDB search
MISNEELHIVGESPLKGEVYISGAKNAALPILCAGLLTEEPIILNNVPELDDVKTILKLL
EHLGAKTSKKNNQTIIQADTIHNTEAPYDLVKTMRASILVLGPLLARYGEARISLPGGCS
IGQRPVDQHIKFLSALGAEIRMEQGFIIAKSKKLQGTVIKPDVVTVTGTENFMMAASLAK
GTTIIENAACEPEITDLAHFLIQMGAKITGHGTRRIKIEGVNYLNGAKYVISPDRIEAGT
FLCALATIGGCINLINVNPHEMTSTLHKLKEAGLEIEIGQNWLKCKMNKKPNAVNINTSE
YPGLATDMQAQFMAMNTVANGTSSITENIFENRYMHVPELRRMGADITIDGNQAIIRGVN
KLYGTTVKATDLRASASLVIAALASKGKTIIESIYHLDRGYEKMEEKLRMLGANILRAPR
KE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgatttccaatgaagagctacatatagtaggagaatcgcccctaaagggagaagtgtat
atatctggagcaaaaaatgcagccttaccaatattatgcgctggattattaactgaagaa
cctatcattctaaacaatgttccagaattagatgatgtaaaaactattctaaaactttta
gagcatcttggtgcaaaaacttcaaaaaaaaataatcaaacaataattcaagcagatacg
atacataatactgaagctccttacgatttagtaaaaaccatgagagcctccatattagtt
ctgggacctttacttgcaagatatggagaggcaagaataagtttaccaggaggatgttca
ataggacaaagacctgttgaccaacatattaaattcttatcagccttaggcgctgaaatc
aggatggaacaaggatttataatagcaaaatcaaaaaaattgcaaggtactgtaataaaa
cctgacgtagtcaccgtaacaggcacagaaaattttatgatggctgcctctttagcaaaa
ggtactactataatagaaaatgcagcttgtgaacctgagatcacagacttggcccatttt
ctgatacaaatgggcgctaagattactggtcatggcacaagacgcataaaaatagaaggc
gttaactacttgaatggcgctaaatatgtaatatcaccagatagaattgaagctgggacc
ttcttatgcgccctagctactattggaggttgtattaacctaataaatgtcaatccgcat
gaaatgacatcaactctccacaaattaaaagaagctggattggagatagaaattggacag
aattggttaaaatgtaaaatgaataaaaaacctaatgctgtaaacattaatactagtgaa
tatccagggctagctacagacatgcaagcacagtttatggcaatgaatactgtagctaac
ggaacttcttctataacagaaaatattttcgaaaatagatatatgcatgtacctgaatta
agaagaatgggtgcagatattacaatagatggtaatcaagctataattcgtggagttaat
aaactctacggcacaactgtaaaagcaactgacttaagagcttcagctagtttagttatc
gcagctttagcatctaaaggaaaaacaataatagagtccatatatcatttagatcgtgga
tatgaaaaaatggaagaaaaacttagaatgttgggagctaatattctaagagcacctaga
aaggaataa

DBGET integrated database retrieval system